KEGG   Homo sapiens (human): 339512
Entry
339512            CDS       T01001                                 
Symbol
CCDC190, C1orf110
Name
(RefSeq) coiled-coil domain containing 190
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CC190 DUF6702
Other DBs
NCBI-GeneID: 339512
NCBI-ProteinID: NP_848645
HGNC: 28736
Ensembl: ENSG00000185860
Pharos: Q86UF4(Tdark)
UniProt: Q86UF4
Position
1:complement(162851020..162868833)
AA seq 302 aa
MERHMVRGQLYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVKLLTWEQRQLQKELQRL
QQAETMKKKFSSYLGNGFQKRPEDVLVFSPQGRQKHRAPQAKKMRALATRMAQDTCKSKS
QVPPSHDAGLKDPMKSKKQPLSQNNRTACFIKEQPQAQEKDSVNPSKDVDPSKGISVPCQ
NQEVSTNTIEQGPSSSPASDSGMACADETRSKDVALKPDGNTGKQIPPKHMECAGSFEGE
FTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL
PL
NT seq 909 nt   +upstreamnt  +downstreamnt
atggagaggcacatggtcaggggacaattgtataagcattttgatttggagaggaagaat
gccaagcaggctgaagccagactggaccaaagactgcagagactaaaggttatttgcctc
taccatgtgaaattgctgacctgggagcagaggcagctccaaaaagaactgcagaggttg
cagcaagcagaaaccatgaagaaaaagttctcctcttatttggggaatggatttcagaag
agaccagaagatgttctcgtgttctcaccacagggaaggcagaagcacagagccccacag
gctaagaaaatgagagcattggcaacccgtatggcccaagacacatgcaaaagcaagtcc
caggtgcctccttcacatgatgctggcctcaaagaccccatgaagagcaaaaagcagcca
ctctctcaaaataacagaactgcctgcttcataaaagagcaaccacaagcccaagagaaa
gattctgtgaatccatctaaggacgtagaccccagcaagggcatctctgttccatgccaa
aatcaagaggtttccaccaacaccatagaacaaggtcctagttccagcccagctagtgat
agtggaatggcatgtgctgatgagaccagatcaaaagatgttgctctaaagccagatggg
aacactggaaaacaaattcccccaaaacacatggaatgtgcaggaagcttcgaaggcgag
ttcacaaagccaaccttcttagagttgctttcaaaggccagaaatgcccattatctccgg
cacagggtcccccctgagtctgagaggttgcttagcattggagagatatttgggcatggg
gaatcctcatcatccagggcaggaaaggagtgtgaaaacagggtgccttctaagtttctt
cctctctaa

DBGET integrated database retrieval system