KEGG   Homo sapiens (human): 339665Help
Entry
339665            CDS       T01001                                 

Gene name
SLC35E4
Definition
(RefSeq) solute carrier family 35 member E4
  KO
K15286  solute carrier family 35, member E4
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   339665 (SLC35E4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPT EamA UAA Mg_trans_NIPA
Motif
Other DBs
NCBI-GeneID: 339665
NCBI-ProteinID: NP_001001479
HGNC: 17058
Ensembl: ENSG00000100036
Vega: OTTHUMG00000151110
Pharos: Q6ICL7(Tdark)
UniProt: Q6ICL7
Position
22q12.2
AA seq 350 aa AA seqDB search
MCRCPPEHHDGRMTSAEVGAAAGGAQAAGPPEWPPGSPQALRQPGRARVAMAALVWLLAG
ASMSSLNKWIFTVHGFGRPLLLSALHMLVAALACHRGARRPMPGGTRCRVLLLSLTFGTS
MACGNVGLRAVPLDLAQLVTTTTPLFTLALSALLLGRRHHPLQLAAMGPLCLGAACSLAG
EFRTPPTGCGFLLAATCLRGLKSVQQSALLQEERLDAVTLLYATSLPSFCLLAGAALVLE
AGVAPPPTAGDSRLWACILLSCLLSVLYNLASFSLLALTSALTVHVLGNLTVVGNLILSR
LLFGSRLSALSYVGIALTLSGMFLYHNCEFVASWAARRGLWRRDQPSKGL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgctgcccgccggagcaccatgatggcaggatgacctcagccgaagtaggagca
gcagctggtggtgctcaggcggctgggccccccgagtggccccctggcagccctcaggcc
ctccggcagcctggccgggcccgagtggccatggcagcactggtgtggctgctggcggga
gccagcatgtcaagcctcaacaagtggatcttcacagtgcacggctttgggcggcccctg
ctgctgtcggccctgcacatgctggtggcagccctggcatgccaccggggggcacggcgc
cccatgccaggcggcactcgctgccgagtcctactgctcagtctcacctttggcacgtcc
atggcctgcggcaacgtgggcctaagggctgtgcccctggacctggcacaactggttact
accaccacacctctgttcaccctggccctgtcggcgctgctgctgggccgccgccaccac
ccacttcagttggccgccatgggtccgctctgcctgggggccgcctgcagcctggctgga
gagttccggacaccccctaccggctgtggcttcctgctcgcagccacctgcctccgcgga
ctcaagtcggttcagcaaagtgccctgctgcaggaggagaggctggacgcggtgaccctg
ctttacgccacctcgctgcccagcttctgcctgctggcgggtgcagccctggtgctggag
gctggcgttgccccaccgcccactgctggcgactctcgcctctgggcctgcatcctgctc
agctgcctcctgtctgttctctataacctggccagcttctccctgctggccctcacctct
gccctcaccgtccacgtcctgggcaacctcaccgtggtgggcaacctcatcctgtcccgg
ctgttgtttggcagccgcctcagtgccctcagctacgtgggcatcgcactcactctttca
ggaatgttcctttaccacaactgcgagttcgtggcctcctgggctgcccgtcgggggctg
tggcggagggaccagcccagcaagggtctttga

DBGET integrated database retrieval system