KEGG   Homo sapiens (human): 3397Help
Entry
3397              CDS       T01001                                 

Gene name
ID1, ID, bHLHb24
Definition
(RefSeq) inhibitor of DNA binding 1, HLH protein
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3397 (ID1)
   04350 TGF-beta signaling pathway
    3397 (ID1)
   04390 Hippo signaling pathway
    3397 (ID1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3397 (ID1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3397 (ID1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3397 (ID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Dsl1_N
Motif
Other DBs
NCBI-GeneID: 3397
NCBI-ProteinID: NP_002156
OMIM: 600349
HGNC: 5360
Ensembl: ENSG00000125968
Vega: OTTHUMG00000032181
Pharos: P41134(Tbio)
UniProt: P41134
Position
20q11.21
AA seq 155 aa AA seqDB search
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaag
gccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtg
gccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcag
caggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtg
cccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgac
tacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggc
cgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacg
gccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctga

KEGG   Homo sapiens (human): 3398Help
Entry
3398              CDS       T01001                                 

Gene name
ID2, GIG8, ID2A, ID2H, bHLHb26
Definition
(RefSeq) inhibitor of DNA binding 2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Network
N00133  EWSR1-FLI1 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3398 (ID2)
   04390 Hippo signaling pathway
    3398 (ID2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3398 (ID2)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    3398 (ID2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3398 (ID2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3398 (ID2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 3398
NCBI-ProteinID: NP_002157
OMIM: 600386
HGNC: 5361
Ensembl: ENSG00000115738
Vega: OTTHUMG00000112454
Pharos: Q02363(Tbio)
UniProt: Q02363 Q53T66
Structure
PDB: 

Position
2p25.1
AA seq 134 aa AA seqDB search
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctg
ggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaac
gactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagc
aagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggac
tcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccagg
acgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattc
ccttctgagttaatgtcaaatgacagcaaagcactgtgtggctga

KEGG   Homo sapiens (human): 3399Help
Entry
3399              CDS       T01001                                 

Gene name
ID3, HEIR-1, bHLHb25
Definition
(RefSeq) inhibitor of DNA binding 3, HLH protein
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3399 (ID3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3399 (ID3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3399 (ID3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3399 (ID3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 3399
NCBI-ProteinID: NP_002158
OMIM: 600277
HGNC: 5362
Ensembl: ENSG00000117318
Pharos: Q02535(Tbio)
UniProt: Q02535
Structure
PDB: 

Position
1p36.12
AA seq 119 aa AA seqDB search
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgagcccggtgcgcggctgctacgaggcggtgtgctgcctgtcggaacgc
agtctggccatcgcccggggccgagggaagggcccggcagctgaggagccgctgagcttg
ctggacgacatgaaccactgctactcccgcctgcgggaactggtacccggagtcccgaga
ggcactcagcttagccaggtggaaatcctacagcgcgtcatcgactacattctcgacctg
caggtagtcctggccgagccagcccctggaccccctgatggcccccaccttcccatccag
acagccgagctcactccggaacttgtcatctccaacgacaaaaggagcttttgccactga

KEGG   Homo sapiens (human): 3400Help
Entry
3400              CDS       T01001                                 

Gene name
ID4, IDB4, bHLHb27
Definition
(RefSeq) inhibitor of DNA binding 4, HLH protein
  KO
K17695  DNA-binding protein inhibitor ID4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3400 (ID4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3400 (ID4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3400 (ID4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3400 (ID4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 3400
NCBI-ProteinID: NP_001537
OMIM: 600581
HGNC: 5363
Ensembl: ENSG00000172201
Vega: OTTHUMG00000014333
Pharos: P47928(Tbio)
UniProt: P47928
Position
6p22.3
AA seq 161 aa AA seqDB search
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgagcccggtgcgcccctcgggccgcaaggcgccgtcgggctgcggcggc
ggggagctggcgctgcgctgcctggccgagcacggccacagcctgggtggctccgcagcc
gcggcggcggcggcggcggcagcgcgctgtaaggcggccgaggcggcggccgacgagccg
gcgctgtgcctgcagtgcgatatgaacgactgctatagccgcctgcggaggctggtgccc
accatcccgcccaacaagaaagtcagcaaagtggagatcctgcagcacgttatcgactac
atcctggacctgcagctggcgctggagacgcacccggccctgctgaggcagccaccaccg
cccgcgccgccacaccacccggccgggacctgtccagccgcgccgccgcggaccccgctc
actgcgctcaacaccgacccggccggcgcggtgaacaagcagggcgacagcattctgtgc
cgctga

DBGET integrated database retrieval system