KEGG   Homo sapiens (human): 339745Help
Entry
339745            CDS       T01001                                 

Gene name
SPOPL, BTBD33
Definition
(RefSeq) speckle type BTB/POZ protein like
  KO
K10523  speckle-type POZ protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    339745 (SPOPL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    339745 (SPOPL)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     339745 (SPOPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB MATH
Motif
Other DBs
NCBI-GeneID: 339745
NCBI-ProteinID: NP_001001664
HGNC: 27934
Ensembl: ENSG00000144228
Vega: OTTHUMG00000153635
Pharos: Q6IQ16(Tdark)
UniProt: Q6IQ16
Position
2q22.1
AA seq 392 aa AA seqDB search
MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLK
VPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMI
QSHPHLVAEAFRALASAQCPQFGIPRKRLKQS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggaacccaccccacctctacctggagatatgtctactggtcccatagcagaa
agctggtgttacacacaggttaaagtagtaaaattttcctatatgtggaccattaataac
ttcagtttttgtcgagaggaaatgggtgaagtgttaaaaagttcaacattttcatctggc
ccaagtgacaaaatgaaatggtgcctgagggtaaacccaaagggattagatgatgaaagt
aaagactacttgtccttatatttgcttttagtcagctgccccaaaagtgaagttcgagca
aaattcaaattttcccttctgaatgctaaaagggaagaaacaaaagcaatggaaagccaa
agagcatatcgatttgtgcaagggaaggactggggttttaaaaaattcattagaagggac
tttttgcttgatgaagctaatggtcttttaccagatgacaagcttacattattttgtgag
gtgagtgtggtccaagattcagtaaacatatcaggacatactaatacaaatactttgaag
gtgcctgagtgtcgtctagcagaagatttaggtaatctctgggaaaacacaagatttaca
gactgcagttttttcgtgagaggacaagaatttaaagctcataaatctgtgcttgcagct
cgatctccagtttttaacgccatgtttgaacatgaaatggaagaaagcaaaaagaatcga
gtggaaataaatgatttagaccctgaagtttttaaagaaatgatgagattcatttacaca
gggagagcaccaaaccttgacaaaatggctgacaacttgttggcagctgcagacaaatat
gcactggaacggctgaaggtcatgtgcgaagaagctttgtgtagtaacctctcagtagag
aatgttgcagatacccttgtccttgcagatttgcacagtgcagaacagttgaaagcacaa
gccatagactttattaataggtgcagtgtacttcgacaacttgggtgtaaagatgggaaa
aactggaacagcaaccaagcaaccgacataatggaaacatcagggtggaagtccatgatt
cagtctcaccctcatttagtagcagaagcctttcgagcactagcatctgcacagtgtcca
cagtttggcattccacgcaaacggctaaaacagtcctga

KEGG   Homo sapiens (human): 8405Help
Entry
8405              CDS       T01001                                 

Gene name
SPOP, BTBD32, TEF2
Definition
(RefSeq) speckle type BTB/POZ protein
  KO
K10523  speckle-type POZ protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    8405 (SPOP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8405 (SPOP)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     8405 (SPOP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB MATH BACK
Motif
Other DBs
NCBI-GeneID: 8405
NCBI-ProteinID: NP_001007227
OMIM: 602650
HGNC: 11254
Ensembl: ENSG00000121067
Vega: OTTHUMG00000161496
Pharos: O43791(Tbio)
UniProt: O43791
Structure
PDB: 

Position
17q21.33
AA seq 374 aa AA seqDB search
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggccccgtagctgag
agttggtgctacacacagatcaaggtagtgaaattctcctacatgtggaccatcaataac
tttagcttttgccgggaggaaatgggtgaagtcattaaaagttctacattttcatcagga
gcaaatgataaactgaaatggtgtttgcgagtaaaccccaaagggttagatgaagaaagc
aaagattacctgtcactttacctgttactggtcagctgtccaaagagtgaagttcgggca
aaattcaaattctccatcctgaatgccaagggagaagaaaccaaagctatggagagtcaa
cgggcatataggtttgtgcaaggcaaagactggggattcaagaaattcatccgtagagat
tttcttttggatgaggccaacgggcttctccctgatgacaagcttaccctcttctgcgag
gtgagtgttgtgcaagattctgtcaacatttctggccagaataccatgaacatggtaaag
gttcctgagtgccggctggcagatgagttaggaggactgtgggagaattcccggttcaca
gactgctgcttgtgtgttgccggccaggaattccaggctcacaaggctatcttagcagct
cgttctccggtttttagtgccatgtttgaacatgaaatggaggagagcaaaaagaatcga
gttgaaatcaatgatgtggagcctgaagtttttaaggaaatgatgtgcttcatttacacg
gggaaggctccaaacctcgacaaaatggctgatgatttgctggcagctgctgacaagtat
gccctggagcgcttaaaggtcatgtgtgaggatgccctctgcagtaacctgtccgtggag
aacgctgcagaaattctcatcctggccgacctccacagtgcagatcagttgaaaactcag
gcagtggatttcatcaactatcatgcttcggatgtcttggagacctctgggtggaagtca
atggtggtgtcacatccccacttggtggctgaggcataccgctctctggcttcagcacag
tgcccttttctgggacccccacgcaaacgcctgaagcaatcctaa

DBGET integrated database retrieval system