KEGG   Homo sapiens (human): 3398Help
Entry
3398              CDS       T01001                                 

Gene name
ID2, GIG8, ID2A, ID2H, bHLHb26
Definition
(RefSeq) inhibitor of DNA binding 2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Network
N00133  EWSR1-FLI1 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3398 (ID2)
   04390 Hippo signaling pathway
    3398 (ID2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3398 (ID2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3398 (ID2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3398 (ID2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 3398
NCBI-ProteinID: NP_002157
OMIM: 600386
HGNC: 5361
Ensembl: ENSG00000115738
Vega: OTTHUMG00000112454
Pharos: Q02363(Tbio)
UniProt: Q02363 Q53T66
Structure
PDB: 

Position
2p25.1
AA seq 134 aa AA seqDB search
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctg
ggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaac
gactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagc
aagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggac
tcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccagg
acgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattc
ccttctgagttaatgtcaaatgacagcaaagcactgtgtggctga

DBGET integrated database retrieval system