KEGG   Homo sapiens (human): 339896Help
Entry
339896            CDS       T01001                                 

Gene name
GADL1, ADC, CSADC, HuADC, HuCSADC
Definition
(RefSeq) glutamate decarboxylase like 1
  KO
K18966  sulfinoalanine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.29 4.1.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00410  beta-Alanine metabolism
hsa00430  Taurine and hypotaurine metabolism
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    339896 (GADL1)
   00430 Taurine and hypotaurine metabolism
    339896 (GADL1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    339896 (GADL1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     339896 (GADL1)
    4.1.1.29  sulfinoalanine decarboxylase
     339896 (GADL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 339896
NCBI-ProteinID: NP_997242
OMIM: 615601
HGNC: 27949
Ensembl: ENSG00000144644
Vega: OTTHUMG00000130621
Pharos: Q6ZQY3(Tbio)
UniProt: Q6ZQY3
Position
3p24.1-p23
AA seq 521 aa AA seqDB search
MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEV
VLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQ
LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
SVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
TDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHV
DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV
DEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLM
LGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgactcggaccgccagtgtcctgtggacggagatattgatcaacaagagatg
attccaagtaagaagaatgctgttcttgtggatggggttgtgctgaatggtcctacaaca
gatgcaaaagctggagaaaaatttgttgaagaggcctgtaggctaataatggaagaggtg
gttttgaaagctacagatgtcaatgagaaggtgtgtgaatggaggcctcctgaacaactg
aaacagcttcttgatttggagatgagagactcaggcgagccaccccataaactattggaa
ctctgtcgggatgtcatacactacagtgtcaaaactaaccacccaagatttttcaaccaa
ttgtatgctggacttgattattactccttggtggcccgatttatgaccgaagcattgaat
ccaagtgtttatacgtatgaggtgtccccagtgtttctgttagtggaagaagcggttctg
aagaaaatgattgaatttattggctggaaagaaggggatggaatatttaacccaggtggc
tcagtgtccaatatgtatgcaatgaatttagctagatacaaatattgtcctgatattaag
gaaaaggggctgtctggttcgccaagattaatccttttcacatctgcagagtgtcattac
tctatgaagaaggcagcctcttttcttgggattggcactgagaatgtttgctttgtggaa
acagatggaagaggtaaaatgatacctgaggaactggagaagcaagtctggcaagccaga
aaagagggggcagcaccgtttcttgtctgtgccacttctggtacaactgtgttgggagct
tttgaccctctggatgaaatagcagacatctgcgagaggcacagcctctggcttcatgta
gatgcttcttggggtggctcagctttgatgtcgaggaagcaccgcaagcttctgcatggc
atccacagggctgactctgtggcctggaacccacacaagatgctgatggctgggatccag
tgctgtgctctccttgtgaaagacaaatctgatcttcttaaaaaatgctactctgccaag
gcatcttacctcttccagcaggataaattctatgatgtgagctatgacacaggagacaag
tctatccagtgtagcagaagaccagatgcattcaagttctggatgacctggaaggccctg
ggtacattaggccttgaagaaagagttaatcgtgctcttgctttatctaggtacctagta
gatgaaatcaagaaaagagaaggattcaagttactgatggaacctgaatatgccaatatt
tgcttttggtacattccaccgagcctcagagagatggaagaaggacccgagttctgggca
aaacttaatttggtggccccagccattaaggagaggatgatgaagaagggaagcttgatg
ctgggctaccagccgcaccggggaaaggtcaacttcttccgccaggtggtgatcagccct
caagtgagccgggaggacatggacttcctcctggatgagatagacttactgggtaaagac
atgtag

DBGET integrated database retrieval system