KEGG   Homo sapiens (human): 339983Help
Entry
339983            CDS       T01001                                 

Gene name
NAT8L, CML3, NACED, NAT8-LIKE
Definition
(RefSeq) N-acetyltransferase 8 like
  KO
K18309  aspartate N-acetyltransferase [EC:2.3.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    339983 (NAT8L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.17  aspartate N-acetyltransferase
     339983 (NAT8L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_3 FR47 Acetyltransf_15 Acetyltransf_8 DUF898 PALB2_WD40 Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 339983
NCBI-ProteinID: NP_848652
OMIM: 610647
HGNC: 26742
Ensembl: ENSG00000185818
Pharos: Q8N9F0(Tbio)
UniProt: Q8N9F0
Position
4p16.3
AA seq 302 aa AA seqDB search
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPV
AQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLL
YALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPP
GSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHN
YSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLR
EE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtgggcctcccgacatggtctgcgagacgaagatcgtggccgccgaggaccat
gaggcgctgccgggggccaagaaggacgcgctgctcgccgccgccggcgccatgtggccc
ccgctgcccgccgcgcccgggccggccgccgcgccccccgcgcccccacctgccccggtg
gctcagcctcacggcggggcggggggcgcggggccgccgggggggcgcggcgtgtgcatc
cgcgagttccgtgcggccgagcaggaggcggcgcgccgcatcttctacgacggcatcatg
gagcgcatccctaacacggccttccgcggcctgcggcagcacccgcgcgcgcagctgctc
tacgccctgctggcggcgctgtgcttcgccgtgagccgctcgctgctgctgacgtgcctg
gtgccggccgcgctgctgggcctgcgctactactacagccgcaaggtgatccgcgcctac
ctggagtgcgcgctgcacacggacatggcggacatcgagcagtactacatgaagccgccc
ggctcctgcttctgggtggccgtgctggatggcaacgtggtgggcattgtggctgcacgg
gcccacgaggaggacaacacggtggagctgctgcggatgtctgtggactcacgtttccga
ggcaagggcatcgccaaggcgctgggccggaaggtgctggagttcgccgtggtgcacaac
tactccgcggtggtgctgggcacgacggccgtcaaggtggccgcccacaagctctacgag
tcgctgggcttcagacacatgggcgccagtgaccactacgtgctgccgggcatgaccctc
tcgctggctgagcgcctcttcttccaggtccgctaccaccgctaccgcctgcagctgcgc
gaggagtga

DBGET integrated database retrieval system