KEGG   Homo sapiens (human): 340156Help
Entry
340156            CDS       T01001                                 

Gene name
MYLK4, SgK085
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    340156 (MYLK4)
   04020 Calcium signaling pathway
    340156 (MYLK4)
   04022 cGMP-PKG signaling pathway
    340156 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    340156 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    340156 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    340156 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    340156 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    340156 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    340156 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    340156 (MYLK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     340156 (MYLK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   340156 (MYLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 340156
NCBI-ProteinID: NP_001012418
HGNC: 27972
Ensembl: ENSG00000145949
Vega: OTTHUMG00000014121
Pharos: Q86YV6(Tchem)
UniProt: Q86YV6
Structure
PDB: 

Position
6p25.2
AA seq 388 aa AA seqDB search
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSN
ADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQV
HKCEETATGLKLAAKIIKTRGMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVM
EYVDGGELFDRIIDESYNLTELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDA
KQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGL
SPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPW
LSDHKLHSRLNAQKKKNRGSDAQDFVTK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagtgaagaggctggaagaattcaacacgtgttataacagcaaccagctggag
aaaatggccttttttcagtgcagggaagaggtggagaaagtgaagtgttttctggaaaaa
aattctggggaccaggattcaagatctggacataatgaggcgaaggaggtgtggtcaaac
gccgacctgacggaaaggatgcccgtcaaaagcaaaaggacatcagccctcgcagttgac
atcccggctcctccggccccatttgatcatcgtattgtgacagccaagcaaggagcggtc
aacagcttctatactgtgagcaagacagaaatcctaggaggagggcgtttcggccaggtt
cacaagtgtgaggagacggccacaggtctgaagctggcagccaaaatcatcaagaccaga
ggcatgaaggacaaggaggaggtgaagaacgagatcagcgtcatgaaccagctggaccac
gcgaacctcatccagctgtacgatgccttcgagtctaagaacgacattgtcctggtcatg
gagtatgtggatggtggggagctgtttgaccgcatcatcgatgagagctacaatttgacg
gagcttgataccatcctgttcatgaagcagatatgtgaggggataaggcacatgcatcag
atgtacattctccacttggacctgaagcctgagaatatcctgtgtgtgaatcgggatgct
aagcaaataaaaattattgattttggattggccagaagatacaaacccagagagaagctg
aaggtgaactttggaaccccagaatttctcgcccctgaagttgtgaactatgattttgtt
tcatttcccactgacatgtggagtgtgggggtcatcgcctatatgctacttagcggtttg
tcgcctttcctgggtgacaatgatgctgagacgctgaacaacatcctggcctgcaggtgg
gacttagaggatgaagaatttcaggacatctcggaggaggccaaggagttcatctctaag
cttctgattaaggagaagagttggcgaataagtgcaagcgaagctctcaagcacccctgg
ttgtcagaccacaagctccactccagactcaatgcccagaagaagaagaatcgtggctct
gatgcccaggactttgtgaccaaatag

DBGET integrated database retrieval system