KEGG   Homo sapiens (human): 340156Help
Entry
340156            CDS       T01001                                 

Gene name
MYLK4, SgK085
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    340156 (MYLK4)
   04020 Calcium signaling pathway
    340156 (MYLK4)
   04022 cGMP-PKG signaling pathway
    340156 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    340156 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    340156 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    340156 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    340156 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    340156 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    340156 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    340156 (MYLK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     340156 (MYLK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   340156 (MYLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 340156
NCBI-ProteinID: NP_001012418
HGNC: 27972
Ensembl: ENSG00000145949
Vega: OTTHUMG00000014121
Pharos: Q86YV6(Tchem)
UniProt: Q86YV6
Structure
PDB: 

Position
6p25.2
AA seq 388 aa AA seqDB search
MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSN
ADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQV
HKCEETATGLKLAAKIIKTRGMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVM
EYVDGGELFDRIIDESYNLTELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDA
KQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGL
SPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPW
LSDHKLHSRLNAQKKKNRGSDAQDFVTK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagtgaagaggctggaagaattcaacacgtgttataacagcaaccagctggag
aaaatggccttttttcagtgcagggaagaggtggagaaagtgaagtgttttctggaaaaa
aattctggggaccaggattcaagatctggacataatgaggcgaaggaggtgtggtcaaac
gccgacctgacggaaaggatgcccgtcaaaagcaaaaggacatcagccctcgcagttgac
atcccggctcctccggccccatttgatcatcgtattgtgacagccaagcaaggagcggtc
aacagcttctatactgtgagcaagacagaaatcctaggaggagggcgtttcggccaggtt
cacaagtgtgaggagacggccacaggtctgaagctggcagccaaaatcatcaagaccaga
ggcatgaaggacaaggaggaggtgaagaacgagatcagcgtcatgaaccagctggaccac
gcgaacctcatccagctgtacgatgccttcgagtctaagaacgacattgtcctggtcatg
gagtatgtggatggtggggagctgtttgaccgcatcatcgatgagagctacaatttgacg
gagcttgataccatcctgttcatgaagcagatatgtgaggggataaggcacatgcatcag
atgtacattctccacttggacctgaagcctgagaatatcctgtgtgtgaatcgggatgct
aagcaaataaaaattattgattttggattggccagaagatacaaacccagagagaagctg
aaggtgaactttggaaccccagaatttctcgcccctgaagttgtgaactatgattttgtt
tcatttcccactgacatgtggagtgtgggggtcatcgcctatatgctacttagcggtttg
tcgcctttcctgggtgacaatgatgctgagacgctgaacaacatcctggcctgcaggtgg
gacttagaggatgaagaatttcaggacatctcggaggaggccaaggagttcatctctaag
cttctgattaaggagaagagttggcgaataagtgcaagcgaagctctcaagcacccctgg
ttgtcagaccacaagctccactccagactcaatgcccagaagaagaagaatcgtggctct
gatgcccaggactttgtgaccaaatag

KEGG   Homo sapiens (human): 4638Help
Entry
4638              CDS       T01001                                 

Gene name
MYLK, AAT7, KRP, MLCK, MLCK1, MLCK108, MLCK210, MMIHS, MSTP083, MYLK1, smMLCK
Definition
(RefSeq) myosin light chain kinase
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa04971  Gastric acid secretion
Disease
H00801  Familial thoracic aortic aneurysm and dissection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4638 (MYLK)
   04020 Calcium signaling pathway
    4638 (MYLK)
   04022 cGMP-PKG signaling pathway
    4638 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    4638 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4638 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    4638 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4638 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4638 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    4638 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4638 (MYLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     4638 (MYLK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   4638 (MYLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Pkinase 23ISL V-set Pkinase_Tyr C2-set_2 fn3 Ig_6 Ig_4 Herpes_gE Izumo-Ig Kinase-like Kdo AvrM_N
Motif
Other DBs
NCBI-GeneID: 4638
NCBI-ProteinID: NP_444253
OMIM: 600922
HGNC: 7590
Ensembl: ENSG00000065534
Vega: OTTHUMG00000141304
Pharos: Q15746(Tchem)
UniProt: Q15746
Structure
PDB: 

Position
3q21.1
AA seq 1914 aa AA seqDB search
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
NT seq 5745 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgtgaagctggttgcctcgtcacacatttccaaaacctccctcagtgtggat
ccctcaagagttgactccatgcccctgacagaggcccctgctttcattttgccccctcgg
aacctctgcatcaaagaaggagccaccgccaagttcgaagggcgggtccggggttaccca
gagccccaggtgacatggcacagaaacgggcaacccatcaccagcgggggccgcttcctg
ctggattgcggcatccgggggactttcagccttgtgattcatgctgtccatgaggaggac
aggggaaagtatacctgtgaagccaccaatggcagtggtgctcgccaggtgacagtggag
ttgacagtagaaggaagttttgcgaagcagcttggtcagcctgttgtttccaaaacctta
ggggatagattttcagctccagcagtggagacccgtcctagcatctggggggagtgccca
ccaaagtttgctaccaagctgggccgagttgtggtcaaagaaggacagatgggacgattc
tcctgcaagatcactggccggccccaaccgcaggtcacctggctcaagggaaatgttcca
ctgcagccgagtgcccgtgtgtctgtgtctgagaagaacggcatgcaggttctggaaatc
catggagtcaaccaagatgacgtgggagtgtacacgtgcctggtggtgaacgggtcgggg
aaggcctcgatgtcagctgaactttccatccaaggtttggacagtgccaataggtcattt
gtgagagaaacaaaagccaccaattcagatgtcaggaaagaggtgaccaatgtaatctca
aaggagtcgaagctggacagtctggaggctgcagccaaaagcaagaactgctccagcccc
cagagaggtggctccccaccctgggctgcaaacagccagcctcagcccccaagggagtcc
aagctggagtcatgcaaggactcgcccagaacggccccgcagaccccggtccttcagaag
acttccagctccatcaccctgcaggccgcaagagttcagccggaaccaagagcaccaggc
ctgggggtcctatcaccttctggagaagagaggaagaggccagctcctccccgtccagcc
accttccccaccaggcagcctggcctggggagccaagatgttgtgagcaaggctgctaac
aggagaatccccatggagggccagagggattcagcattccccaaatttgagagcaagccc
caaagccaggaggtcaaggaaaatcaaactgtcaagttcagatgtgaagtttccgggatt
ccaaagcctgaagtggcctggttcctggaaggcacccccgtgaggagacaggaaggcagc
attgaggtttatgaagatgctggctcccattacctctgcctgctgaaagcccggaccagg
gacagtgggacatacagctgcactgcttccaacgcccaaggccagctgtcctgtagctgg
accctccaagtggaaaggcttgccgtgatggaggtggccccctccttctccagtgtcctg
aaggactgcgctgttattgagggccaggattttgtgctgcagtgctccgtacgggggacc
ccagtgccccggatcacttggctgctgaatgggcagcccatccagtacgctcgctccacc
tgcgaggccggcgtggctgagctccacatccaggatgccctgccggaggaccatggcacc
tacacctgcctagctgagaatgccttggggcaggtgtcctgcagcgcctgggtcaccgtc
catgaaaagaagagtagcaggaagagtgagtaccttctgcctgtggctcccagcaagccc
actgcacccatcttcctgcagggcctctctgatctcaaagtcatggatggaagccaggtc
actatgactgtccaagtgtcagggaatccaccccctgaagtcatctggctgcacaatggg
aatgagatccaagagtcagaggacttccactttgaacagagaggaactcagcacagcctt
tgtatccaggaagtgttcccggaggacacgggcacgtacacctgcgaggcctggaacagc
gctggagaggtccgcacccaggccgtgctcacggtacaagagcctcacgatggcacccag
ccctggttcatcagtaagcctcgctcagtgacagcctccctgggccagagtgtcctcatc
tcctgcgccatagctggtgacccctttcctaccgtgcactggctcagagatggcaaagcc
ctctgcaaagacactggccacttcgaggtgcttcagaatgaggacgtgttcaccctggtt
ctaaagaaggtgcagccctggcatgccggccagtatgagatcctgctcaagaaccgggtt
ggcgaatgcagttgccaggtgtcactgatgctacagaacagctctgccagagcccttcca
cgggggagggagcctgccagctgcgaggacctctgtggtggaggagttggtgctgatggt
ggtggtagtgaccgctatgggtccctgaggcctggctggccagcaagagggcagggttgg
ctagaggaggaagacggcgaggacgtgcgaggggtgctgaagaggcgcgtggagacgagg
cagcacactgaggaggcgatccgccagcaggaggtggagcagctggacttccgagacctc
ctggggaagaaggtgagtacaaagaccctatcggaagacgacctgaaggagatcccagcc
gagcagatggatttccgtgccaacctgcagcggcaagtgaagccaaagactgtgtctgag
gaagagaggaaggtgcacagcccccagcaggtcgattttcgctctgtcctggccaagaag
gggacttccaagacccccgtgcctgagaaggtgccaccgccaaaacctgccaccccggat
tttcgctcagtgctgggtggcaagaagaaattaccagcagagaatggcagcagcagtgcc
gagaccctgaatgccaaggcagtggagagttccaagcccctgagcaatgcacagccttca
gggcccttgaaacccgtgggcaacgccaagcctgctgagaccctgaagccaatgggcaac
gccaagcctgccgagaccctgaagcccatgggcaatgccaagcctgatgagaacctgaaa
tccgctagcaaagaagaactcaagaaagacgttaagaatgatgtgaactgcaagagaggc
catgcagggaccacagataatgaaaagagatcagagagccaggggacagccccagccttc
aagcagaagctgcaagatgttcatgtggcagagggcaagaagctgctgctccagtgccag
gtgtcttctgaccccccagccaccatcatctggacgctgaacggaaagaccctcaagacc
accaagttcatcatcctctcccaggaaggctcactctgctccgtctccatcgagaaggca
ctgcctgaggacagaggcttatacaagtgtgtagccaagaatgacgctggccaggcggag
tgctcctgccaagtcaccgtggatgatgctccagccagtgagaacaccaaggccccagag
atgaaatcccggaggcccaagagctctcttcctcccgtgctaggaactgagagtgatgcg
actgtgaaaaagaaacctgcccccaagacacctccgaaggcagcaatgccccctcagatc
atccagttccctgaggaccagaaggtacgcgcaggagagtcagtggagctgtttggcaaa
gtgacaggcactcagcccatcacctgtacctggatgaagttccgaaagcagatccaggaa
agcgagcacatgaaggtggagaacagcgagaatggcagcaagctcaccatcctggccgcg
cgccaggagcactgcggctgctacacactgctggtggagaacaagctgggcagcaggcag
gcccaggtcaacctcactgtcgtggataagccagaccccccagctggcacaccttgtgcc
tctgacattcggagctcctcactgaccctgtcctggtatggctcctcatatgatgggggc
agtgctgtacagtcctacagcatcgagatctgggactcagccaacaagacgtggaaggaa
ctagccacatgccgcagcacctctttcaacgtccaggacctgctgcctgaccacgaatat
aagttccgtgtacgtgcaatcaacgtgtatggaaccagtgagccaagccaggagtctgaa
ctcacaacggtaggagagaaacctgaagagccgaaggatgaagtggaggtgtcagatgat
gatgagaaggagcccgaggttgattaccggacagtgacaatcaatactgaacaaaaagta
tctgacttctacgacattgaggagagattaggatctgggaaatttggacaggtctttcga
cttgtagaaaagaaaactcgaaaagtctgggcagggaagttcttcaaggcatattcagca
aaagagaaagagaatatccggcaggagattagcatcatgaactgcctccaccaccctaag
ctggtccagtgtgtggatgcctttgaagaaaaggccaacatcgtcatggtcctggagatc
gtgtcaggaggggagctgtttgagcgcatcattgacgaggactttgagctgacggagcgt
gagtgcatcaagtacatgcggcagatctcggagggagtggagtacatccacaagcagggc
atcgtgcacctggacctcaagccggagaacatcatgtgtgtcaacaagacgggcaccagg
atcaagctcatcgactttggtctggccaggaggctggagaatgcggggtctctgaaggtc
ctctttggcaccccagaatttgtggctcctgaagtgatcaactatgagcccatcggctac
gccacagacatgtggagcatcggggtcatctgctacatcctagtcagtggcctttccccc
ttcatgggagacaacgataacgaaaccttggccaacgttacctcagccacctgggacttc
gacgacgaggcattcgatgagatctccgacgatgccaaggatttcatcagcaatctgctg
aagaaagatatgaaaaaccgcctggactgcacgcagtgccttcagcatccatggctaatg
aaagataccaagaacatggaggccaagaaactctccaaggaccggatgaagaagtacatg
gcaagaaggaaatggcagaaaacgggcaatgctgtgagagccattggaagactgtcctct
atggcaatgatctcagggctcagtggcaggaaatcctcaacagggtcaccaaccagcccg
ctcaatgcagaaaaactagaatctgaagaagatgtgtcccaagctttccttgaggctgtt
gctgaggaaaagcctcatgtaaaaccctatttctctaagaccattcgcgatttagaagtt
gtggagggaagtgctgctagatttgactgcaagattgaaggatacccagaccccgaggtt
gtctggttcaaagatgaccagtcaatcagggagtcccgccacttccagatagactacgat
gaggacgggaactgctctttaattattagtgatgtttgcggggatgacgatgccaagtac
acctgcaaggctgtcaacagtcttggagaagccacctgcacagcagagctcattgtggaa
acgatggaggaaggtgaaggggaaggggaagaggaagaagagtga

KEGG   Homo sapiens (human): 85366Help
Entry
85366             CDS       T01001                                 

Gene name
MYLK2, KMLC, MLCK, MLCK2, skMLCK
Definition
(RefSeq) myosin light chain kinase 2
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    85366 (MYLK2)
   04020 Calcium signaling pathway
    85366 (MYLK2)
   04022 cGMP-PKG signaling pathway
    85366 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    85366 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    85366 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    85366 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    85366 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    85366 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    85366 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    85366 (MYLK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     85366 (MYLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   85366 (MYLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 85366
NCBI-ProteinID: NP_149109
OMIM: 606566
HGNC: 16243
Ensembl: ENSG00000101306
Vega: OTTHUMG00000032194
Pharos: Q9H1R3(Tbio)
UniProt: Q9H1R3
Structure
PDB: 

Position
20q11.21
AA seq 596 aa AA seqDB search
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL
NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagaaaatggagcagttgagctgggaattcagaacccatcaacagacaaggca
cctaaaggtcccacaggtgaaagacccctggctgcagggaaagaccctggccccccagac
ccaaagaaagctccggatccacccaccctgaagaaagatgccaaagcccctgcctcagag
aaaggggatggtaccctggcccaaccctcaactagcagccaaggccccaaaggagagggt
gacaggggcggggggcccgcggagggcagtgctgggcccccggcagccctgccccagcag
actgcgacacctgagaccagcgtcaagaagcccaaggctgagcagggagcctcaggcagc
caggatcctggaaagcccagggtgggcaagaaggcagcagagggccaagcagcagccagg
aggggctcacctgcctttctgcatagccccagctgtcctgccatcatctccagttctgag
aagctgctggccaagaagcccccaagcgaggcatcagagctcacctttgaaggggtgccc
atgacccacagccccacggatcccaggccagccaaggcagaagaaggaaagaacatcctg
gcagagagccagaaggaagtgggagagaaaaccccaggccaggctggccaggctaagatg
caaggggacacctcgagggggattgagttccaggctgttccctcagagaaatccgaggtg
gggcaggccctctgtctcacagccagggaggaggactgcttccagattttggatgattgc
ccgccacctccggcccccttccctcaccgcatggtggagctgaggaccgggaatgtcagc
agtgaattcagtatgaactccaaggaggcgctcggaggtggcaagtttggggcagtctgt
acctgcatggagaaagccacaggcctcaagctggcagccaaggtcatcaagaaacagact
cccaaagacaaggaaatggtgttgctggagattgaggtcatgaaccagctgaaccaccgc
aatctgatccagctgtatgcagccatcgagactccgcatgagatcgtcctgttcatggag
tacatcgagggcggagagctcttcgagaggattgtggatgaggactaccatctgaccgag
gtggacaccatggtgtttgtcaggcagatctgtgacgggatcctcttcatgcacaagatg
agggttttgcacctggacctcaagccagagaacatcctgtgtgtcaacaccaccgggcat
ttggtgaagatcattgactttggcctggcacggaggtataaccccaacgagaagctgaag
gtgaactttgggaccccagagttcctgtcacctgaggtggtgaattatgaccaaatctcc
gataagacagacatgtggagtatgggggtgatcacctacatgctgctgagcggcctctcc
cccttcctgggagatgatgacacagagaccctaaacaacgttctatctggcaactggtac
tttgatgaagagacctttgaggccgtatcagacgaggccaaagactttgtctccaacctc
atcgtcaaggaccagagggcccggatgaacgctgcccagtgtctcgcccatccctggctc
aacaacctggcggagaaagccaaacgctgtaaccgacgccttaagtcccagatcttgctt
aagaaatacctcatgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaac
cgcttcaagaagatcagcagctcgggggcactgatggctctgggggtctga

KEGG   Homo sapiens (human): 91807Help
Entry
91807             CDS       T01001                                 

Gene name
MYLK3, MLCK, MLCK2, caMLCK
Definition
(RefSeq) myosin light chain kinase 3
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    91807 (MYLK3)
   04020 Calcium signaling pathway
    91807 (MYLK3)
   04022 cGMP-PKG signaling pathway
    91807 (MYLK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    91807 (MYLK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    91807 (MYLK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    91807 (MYLK3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    91807 (MYLK3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    91807 (MYLK3)
  09154 Digestive system
   04971 Gastric acid secretion
    91807 (MYLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    91807 (MYLK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     91807 (MYLK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   91807 (MYLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo XhlA APH DUF4680
Motif
Other DBs
NCBI-GeneID: 91807
NCBI-ProteinID: NP_872299
OMIM: 612147
HGNC: 29826
Ensembl: ENSG00000140795
Vega: OTTHUMG00000132543
Pharos: Q32MK0(Tchem)
UniProt: Q32MK0
Position
16q11.2
AA seq 819 aa AA seqDB search
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaacctccaaggagagtctggggcatggggggctgccagggttgggcaagacc
tgcttaacaaccatggacacaaagctgaacatgctgaacgagaaggtggaccagctcctg
cacttccaagaagatgtcacagagaagttgcagagcatgtgccgagacatgggccacctg
gagcggggcctgcacaggctggaggcctcccgggcaccgggcccgggcggggctgatggg
gttccccacattgacacccaggctgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgcggcccagcacggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacgttccagaaatcaaaggtggcggatttc
ctcatgcaggggcgtgtgccctggaggagaggcagcccaggtgacagccctgaggagaat
aaagagcgagtggaagaagagggaggaaaaccaaagcatgtgctgagcaccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggcggacgtgctggaggggaca
gcggagaggctgccccccatcagagcgtcagggctgggagctgaccccgcccaggcagtg
gtctcaccgggccagggagatggtgttcctggcccagcccaggcattccctggccacctg
cccctgcccacaaaggtggaagccaaggctcctgagacacccagcgagaacctcaggact
ggcctggaattggctccagcacccggcagggtcaatgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcatcgtccagcaggcctgaccctgagcccttagaggaa
ggcacgaggctgactccagggcctggccctcagtgcccagggcctccagggctgccagcc
caggccagggcaacccacagtggtggagaaacacctccaaggatctccatccacatacaa
gagatggatactcctggggagatgctgatgacaggcaggggcagccttggacccaccctc
accacagaggctccagcagctgcccagccaggcaagcagggcccacctgggaccgggcgc
tgcctccaagcccctgggactgagcccggagaacagacccctgaaggagccagagagctc
tccccgctgcaggagagcagcagccccgggggagtgaaggcagaggaggagcaaagggct
ggggccgagcctggcacgagaccaagcttggccaggagtgacgacaatgaccacgaggtt
ggggccctgggcctgcagcagggcaaaagcccaggggcgggaaaccctgagcctgagcag
gactgtgcagccagggctccggtgagagctgaagcagtaaggaggatgcccccaggcgcc
gaggctggcagcgtggttctggatgacagtccggccccaccagctccttttgaacaccgg
gtagtgagcgtcaaggagacctccatctctgcgggttacgaggtgtgccagcacgaagtc
ttgggagggggtcggtttggccaggtccacaggtgcacagagaagtccacaggcctccca
ctggctgccaagatcatcaaagtgaagagcgccaaggaccgggaggacgtgaagaacgag
atcaacatcatgaaccagctcagccacgtgaacctgatccagctctatgacgccttcgag
agcaagcacagctgcacccttgtcatggagtacgtggacgggggtgagctcttcgaccgg
atcacagatgagaagtaccacctgactgagctggatgtggtcctgttcaccaggcagatc
tgtgagggtgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgcgtcaatcagacaggacatcaaattaagatcattgactttgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagtcgtcaattatgagtttgtctcattccccacagacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcagagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggactttgtttcccggttgctggtcaaagagaagagctgcagaatgagt
gccacacagtgcctgaaacacgagtggctgaataatttgcctgccaaagcttcaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccaacttctccctaa

DBGET integrated database retrieval system