KEGG   Homo sapiens (human): 340267Help
Entry
340267            CDS       T01001                                 

Gene name
COL28A1, COL28
Definition
(RefSeq) collagen type XXVIII alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen VWA VWA_2 Kunitz_BPTI VWA_3 VWA_CoxE Ku_N
Motif
Other DBs
NCBI-GeneID: 340267
NCBI-ProteinID: NP_001032852
OMIM: 609996
HGNC: 22442
Ensembl: ENSG00000215018
Vega: OTTHUMG00000150034
Pharos: Q2UY09(Tdark)
UniProt: Q2UY09
Position
7p21.3
AA seq 1125 aa AA seqDB search
MWNRYFVFYLLLLSAFTSQTVSGQRKKGPKSNLLARKSDVQGSICFIDIVFIVDSSESSK
IALFDKQKDFVDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQK
VKSMNLIGQGTFSYYAISNATRLLKREGRKDGVKVVLLMTDGIDHPKNPDVQSISEDARI
SGISFITIALSTVVNEAKLRLISGDSSSEPTLLLSDPTLVDKIQDRLDILFEKKCERKIC
ECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNAQKGEAGERGPGGIPGYKGDKGERGEC
GKPGIKGDKGSPGPYGPKGPRGIQGITGPPGDPGPKGFQGNKGEPGPPGPYGSPGAPGIG
QQGIKGERGQEGRPGAPGPIGVGEPGQPGPRGPEGVPGERGLPGEGFPGPKGEKGSEGPT
GPQGLQGLSIKGEKGDIGPVGPQGPMGIPGIGSQGEQGIQGPIGPPGPQGPAGQGLPGSK
GEVGQMGPTGPRGPVGIGVQGPKGEPGSIGLPGQPGVPGEDGAAGKKGEAGLPGARGPEG
PPGKGQPGPKGDEGKKGSKGNQGQRGLPGPEGPKGEPGIMGPFGMPGTSIPGPPGPKGDR
GGPGIPGFKGEPGLSIRGPKGVQGPRGPVGAPGLKGDGYPGVPGPRGLPGPPGPMGLRGV
GDTGAKGEPGVRGPPGPSGPRGVGTQGPKGDTGQKGLPGPPGPPGYGSQGIKGEQGPQGF
PGPKGTMGHGLPGQKGEHGERGDVGKKGDKGEIGEPGSPGKQGLQGPKGDLGLTKEEIIK
LITEICGCGPKCKETPLELVFVIDSSESVGPENFQIIKNFVKTMADRVALDLATARIGII
NYSHKVEKVANLKQFSSKDDFKLAVDNMQYLGEGTYTATALQAANDMFEDARPGVKKVAL
VITDGQTDSRDKEKLTEVVKNASDTNVEIFVIGVVKKNDPNFEIFHKEMNLIATDPEHVY
QFDDFFTLQDTLKQKLFQKICEDFDSYLVQIFGSSSPQPGFGMSGEELSESTPEPQKEIS
ESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGN
CGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETCIQG
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagatattttgtcttctatctcctgcttttgtcagcgtttacgagtcaaaca
gtatccggacaaagaaagaaaggaccaaaatcaaatttgcttgcaaggaaaagtgatgtc
cagggctccatttgtttcatagatattgtcttcatcgtggacagctctgaaagttctaaa
attgccctctttgataaacagaaagattttgtggatagcttgagtgacaagattttccaa
ttgactcctggtcgctccttggaatatgacatcaaactggcagcccttcagtttagcagc
tctgtccaaattgatccacctttttcttcctggaaggacctgcagacatttaagcagaag
gtcaagtctatgaatttaatagggcaaggtaccttctcttattatgccatttccaatgcc
actaggctacttaagagagaagggcgtaaggatggtgtgaaagtggttttgctgatgact
gatggcatcgaccatccaaagaatccagatgttcaaagtatttctgaagatgccagaatt
tcaggaatatcatttatcaccattgcactttctacggtagtcaatgaagccaaacttcgt
ttgatttctggggattcatccagtgaacccactttactgttgagtgatccaacccttgta
gataaaattcaagatcgtctggatatcttatttgaaaagaagtgtgaacgcaagatttgt
gaatgtgagaagggagatccaggtgatccagggcctcctggtacacatggaaatccaggt
atcaaaggtgagcgaggaccaaaaggaaacccgggcaacgctcaaaaaggagaagctgga
gaaagaggtccagggggaattcctgggtacaagggtgacaagggtgaacgtggggaatgt
ggtaaaccagggataaaaggtgacaagggatccccagggccatatggaccaaagggaccc
agaggaattcagggaattactggacctccaggagacccaggcccaaaggggtttcaaggc
aataagggtgagccaggtcctcctggtccttatggttctccaggagctcctggaattgga
cagcaaggtattaagggagaaagaggccaagaaggaagaccgggagctccaggacccatt
ggagttggtgagcctggacagccaggtccccgtggtcctgagggagtaccaggagagagg
ggcttacccggagaaggatttccaggaccaaagggtgaaaaaggttctgaaggaccaact
ggcccacagggattacaaggcctgtcaatcaaaggggagaagggggatataggacctgtg
ggaccccaaggaccaatgggtatccctggaatcgggagtcaaggggaacagggaatccaa
ggtcctattggtccacctggtccacaagggcccgcaggacagggcttacctggttccaag
ggagaagtaggccaaatgggacctacaggccctcgaggaccagtgggaattggagtacaa
ggtccaaagggagagccaggctcaatagggctcccaggacaaccaggagtaccaggagaa
gatggagctgcagggaagaagggagaagcggggcttccgggagcaagaggcccagaagga
ccacctggaaaaggacagcctggccccaagggtgacgaaggcaagaaagggagcaaagga
aatcaaggacagaggggacttccagggcccgaaggaccaaagggtgaaccgggcattatg
ggcccttttggaatgcctggaacatcaattcctggaccacctgggccaaagggagataga
ggaggacctgggatacctggatttaagggagaacctggactttctattcgaggaccaaag
ggtgtccaaggccctcggggaccagtgggtgctccaggactcaaaggtgatggctatcct
ggtgtgcctggacctcgtggattaccaggaccccctgggccgatgggtttacgtggagtg
ggagacactggagcaaagggagagcctggggtcagaggccctccaggtccttctgggcct
cggggcgtaggaacccaagggccaaagggtgatactgggcagaaaggcttgcctggccct
cctggcccccctggctatggatcacagggaattaaaggggaacaaggaccacaaggcttc
ccaggcccaaagggcacaatgggccatggcctcccaggccagaagggagagcacggagaa
cggggcgatgtgggaaagaaaggtgataaaggagaaattggagagcctggatctccagga
aaacagggtttacaaggacccaaaggagacctaggacttacaaaagaagaaattatcaaa
cttattacagaaatatgtggttgtgggcccaaatgcaaagagactccactagagctggtg
tttgtgatcgacagctcagaaagcgtggggccagagaactttcagatcattaaaaatttt
gtgaagactatggctgaccgggttgctctggaccttgccacggcccgcataggcataatc
aactatagccataaggtggagaaggtggctaatttgaagcagttctccagcaaggatgac
ttcaagttggctgtggacaacatgcagtatctgggggaaggcacatacacagccactgct
ctgcaagcagccaacgacatgtttgaagatgcaaggccaggtgtaaaaaaagtggccttg
gtcatcactgatggacagacagattctcgtgataaagagaaactgacagaggtggtgaag
aatgccagtgacaccaatgtggagatatttgtgataggggtggtgaagaaaaatgatccc
aactttgaaatattccacaaagaaatgaatctaattgctactgacccagagcatgtttac
cagtttgatgatttctttaccctgcaagacaccctgaagcaaaaattgtttcaaaaaatt
tgtgaggattttgattcctatctcgttcaaatttttggttcatcgtcacctcaacctgga
tttgggatgtcaggggaagaactcagtgaatctactccagagcctcaaaaagaaatttct
gagtcattgagtgtcaccagagaccaggatgaagatgataaggctccagagccaacgtgg
gctgatgatctgcctgccactacctcatctgaggccaccaccacccccaggccactgctc
agcacccctgtggatggggcagaggatcctagatgtttggaagccttgaagcctggaaac
tgtggtgaatatgtggttcgatggtattatgacaaacaggtcaactcttgtgcccgattt
tggttcagtggctgtaatggctcaggaaatagattcaacagtgaaaaggaatgtcaagaa
acctgcattcaaggatga

DBGET integrated database retrieval system