KEGG   Homo sapiens (human): 340273Help
Entry
340273            CDS       T01001                                 

Gene name
ABCB5, ABCB5alpha, ABCB5beta, EST422562
Definition
(RefSeq) ATP binding cassette subfamily B member 5
  KO
K05660  ATP-binding cassette, subfamily B (MDR/TAP), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    340273 (ABCB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    340273 (ABCB5)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    340273 (ABCB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 AAA_29 AAA_15 Zeta_toxin G-alpha AAA_30 AAA_21 AAA_5 AAA_33 RsgA_GTPase SbcCD_C AAA_18 Resolvase DUF2207
Motif
Other DBs
NCBI-GeneID: 340273
NCBI-ProteinID: NP_001157413
OMIM: 611785
HGNC: 46
Ensembl: ENSG00000004846
Vega: OTTHUMG00000094789
Pharos: Q2M3G0(Tbio)
UniProt: Q2M3G0
Position
7p21.1
AA seq 1257 aa AA seqDB search
MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGA
CLPLMPLVLGEMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIF
GYIQISLWIITAARQTKRIRKQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGD
KIALLFQNMSTFSIGLAVGLVKGWKLTLVTLSTSPLIMASAAACSRMVISLTSKELSAYS
KAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFGIKRTIASKVSLGAVYFFMNG
TYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFAIARGAAFHIF
QVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISN
NIKYGRDDVTDEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALV
RNPKILILDEATSALDSESKSAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGML
AEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFID
KAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASVLNGTVHPVFSIIFAKIITMF
GNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRHLAFKAMLYQD
IAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMY
EEMLQTQHRNTSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTA
IAYGAMAIGETLVLAPEYSKAKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREV
SFFYPCRPDVFILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVD
AKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANAANIHSFIEG
LPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDSEKVVQHALDK
ARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcagaaagagctgaagaaatgcaagaaaattatcagagaaatggaactgca
gaagaacagccaaaactgagaaaggaagcagttggatctattgagatattccgctttgct
gatggactggacatcacactcatgatcctgggtatactggcatcactggtcaatggagcc
tgccttcctttaatgccactggttttaggagaaatgagtgataaccttattagtggatgt
ctagtccaaactaacacaacaaattatcagaactgtactcagtctcaagagaagctgaat
gaagatatgactctgttgaccctgtattatgttggaataggtgttgctgccttgattttt
ggttacatacagatttccttgtggattataactgcagcacgacagaccaagaggattcga
aaacagttttttcattcagttttggcacaggacatcggctggtttgatagctgtgacatc
ggtgaacttaacactcgcatgacagatgacattgacaaaatcagtgatggtattggagat
aagattgctctgttgtttcaaaacatgtctactttttcgattggcctggcagttggtttg
gtgaagggctggaaactcaccctagtgactctatccacgtctcctcttataatggcttca
gcggcagcatgttctaggatggtcatctcattgaccagtaaggaattaagtgcctattcc
aaagctggggctgtggcagaagaagtcttgtcatcaatccgaacagtcatagcctttagg
gcccaggagaaagaacttcaaaggtatacacagaatctcaaagatgcaaaggattttggc
ataaaaaggactatagcttcaaaagtgtctcttggtgctgtgtacttctttatgaatgga
acctatggacttgctttttggtatggaacctccttgattcttaatggagaacctggatat
accatcgggactgttcttgctgttttctttagtgtaatccatagcagttattgcattgga
gcagcagtccctcactttgaaaccttcgcaatagcccgaggagctgcctttcatattttc
caggttattgataagaaacccagtatagataacttttccacagctggatataaacctgaa
tccatagaaggaactgtggaatttaaaaatgtttctttcaattatccatcaagaccatct
atcaagattctgaaaggtctgaatctcagaattaagtctggagagacagtcgccttggtc
ggtctcaatggcagtgggaagagtacggtagtccagcttctgcagaggttatatgatccg
gatgatggctttatcatggtggatgagaatgacatcagagctttaaatgtgcggcattat
cgagaccatattggagtggttagtcaagagcctgttttgttcgggaccaccatcagtaac
aatatcaagtatggacgagatgatgtgactgatgaagagatggagagagcagcaagggaa
gcaaatgcgtatgattttatcatggagtttcctaataaatttaatacattggtaggggaa
aaaggagctcaaatgagtggagggcagaaacagaggatcgcaattgctcgtgccttagtt
cgaaaccccaagattctgattttagatgaggctacgtctgccctggattcagaaagcaag
tcagctgttcaagctgcactggagaaggcgagcaaaggtcggactacaatcgtggtagca
caccgactttctactattcgaagtgcagatttgattgtgaccctaaaggatggaatgctg
gcggagaaaggagcacatgctgaactaatggcaaaacgaggtctatattattcacttgtg
atgtcacaggatattaaaaaagctgatgaacagatggagtcaatgacatattctactgaa
agaaagaccaactcacttcctctgcactctgtgaagagcatcaagtcagacttcattgac
aaggctgaggaatccacccaatctaaagagataagtcttcctgaagtctctctattaaaa
attttaaagttaaacaagcctgaatggccttttgtggttctggggacattggcttctgtt
ctaaatggaactgttcatccagtattttccatcatctttgcaaaaattataaccatgttt
ggaaataatgataaaaccacattaaagcatgatgcagaaatttattccatgatattcgtc
attttgggtgttatttgctttgtcagttatttcatgcagggattattttacggcagagca
ggggaaattttaacgatgagattaagacacttggccttcaaagccatgttatatcaggat
attgcctggtttgatgaaaaggaaaacagcacaggaggcttgacaacaatattagccata
gatatagcacaaattcaaggagcaacaggttccaggattggcgtcttaacacaaaatgca
actaacatgggactttcagttatcatttcctttatatatggatgggagatgacattcctg
attctgagtattgctccagtacttgccgtgacaggaatgattgaaaccgcagcaatgact
ggatttgccaacaaagataagcaagaacttaagcatgctggaaagatagcaactgaagct
ttggagaatatacgtactatagtgtcattaacaagggaaaaagccttcgagcaaatgtat
gaagagatgcttcagactcaacacagaaatacctcgaagaaagcacagattattggaagc
tgttatgcattcagccatgcctttatatattttgcctatgcggcagggtttcgatttgga
gcctatttaattcaagctggacgaatgaccccagagggcatgttcatagtttttactgca
attgcatatggagctatggccatcggagaaacgctcgttttggctcctgaatattccaaa
gccaaatcgggggctgcgcatctgtttgccttgttggaaaagaaaccaaatatagacagc
cgcagtcaagaagggaaaaagccagacacatgtgaagggaatttagagtttcgagaagtc
tctttcttctatccatgtcgcccagatgttttcatcctccgtggcttatccctcagtatt
gagcgaggaaagacagtagcatttgtggggagcagcggctgtgggaaaagcacttctgtt
caacttctgcagagactttatgaccccgtgcaaggacaagtgctgtttgatggtgtggat
gcaaaagaattgaatgtacagtggctccgttcccaaatagcaatcgttcctcaagagcct
gtgctcttcaactgcagcattgctgagaacatcgcctatggtgacaacagccgtgtggtg
ccattagatgagatcaaagaagccgcaaatgcagcaaatatccattcttttattgaaggt
ctccctgagaaatacaacacacaagttggactgaaaggagcacagctttctggcggccag
aaacaaagactagctattgcaagggctcttctccaaaaacccaaaattttattgttggat
gaggccacttcagccctcgataatgacagtgagaaggtggttcagcatgcccttgataaa
gccaggacgggaaggacatgcctagtggtcactcacaggctctctgcaattcagaacgca
gatttgatagtggttctgcacaatggaaagataaaggaacaaggaactcatcaagagctc
ctgagaaatcgagacatatattttaagttagtgaatgcacagtcagtgcagtga

DBGET integrated database retrieval system