KEGG   Homo sapiens (human): 340351Help
Entry
340351            CDS       T01001                                 

Gene name
AGBL3, CCP3
Definition
(RefSeq) ATP/GTP binding protein like 3
  KO
K23437  cytosolic carboxypeptidase protein 2/3 [EC:3.4.17.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    340351 (AGBL3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.-  
     340351 (AGBL3)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   340351 (AGBL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pepdidase_M14_N Peptidase_M14 AstE_AspA
Motif
Other DBs
NCBI-GeneID: 340351
NCBI-ProteinID: NP_848658
OMIM: 617346
HGNC: 27981
Ensembl: ENSG00000146856
Vega: OTTHUMG00000155406
Pharos: Q8NEM8(Tbio)
UniProt: Q8NEM8
Position
7q33
AA seq 920 aa AA seqDB search
MSEDSEKEDYSDRTISDEDESDEDMFMKFVSEDLHRCALLTADSFGDPFFPRTTQILLEY
QLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDEKVQHIDWTPSCPEPVYIPTGLE
TEPLYPDSKEATVVYLAEDAYKEPCFVYSRVGGNRTPLKQPVDYRDNTLMFEARFESGNL
QKVVKVAEYEYQLTVRPDLFTNKHTQWYYFQVTNMRAGIVYRFTIVNFTKPASLYSRGMR
PLFYSEKEAKAHHIGWQRIGDQIKYYRNNPGQDGRHYFSLTWTFQFPHNKDTCYFAHCYP
YTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILT
ARVHPGETNSSWIMKGFLDYILGNSSDAQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGR
DLNRNYTSLLKESFPSVWYTRNMVHRLMEKREVILYCDLHGHSRKENIFMYGCDGSDRSK
TLYLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVVMWKMGIRNSFTMEATFCGS
TLGNKRGTHFSTKDLESMGYHFCDSLLDYCDPDRTKYYRCLKELEEMERHITLEKVFEDS
DTPVIDITLDVESSSRGSDSSESIDSLTYLLKLTSQKKHLKTKKERNSTIASHQNARGQE
VYDRGHLLQRHTQSNSDVKDTRPNEPDDYMVDYFRRQLPNQGLDLHHNLKSKIKECISFQ
SKKTGINWTDDEKRSYKDKGIVQTQEILQYLLPIVHSTKNMQTTQIKQLFNPRTNFQIQH
QLNPATCRNIKKYSTSWTAPRNHPFVIQGDVMANSSEWVQSKPHRSLESLSPLKGPKKNK
HSQIWAIKNEDIKPLSSKWETASSSFGMDANVLKYKSLQAEETNQQSSKHTALHLTKNKD
EQANKNDGQPTLYLKFQRES
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagattcagaaaaggaagactattcagacagaacaatcagtgatgaagatgaa
tcggatgaggatatgttcatgaaatttgtaagtgaagatcttcatcggtgtgcactttta
acagctgactcttttggtgatcccttcttcccccggactacacagatactattagaatat
cagctagggagatgggtgccacgtcttcgtgaaccaagggatttatatggtgtctcttct
tctggtccattgagcccaacacggtggccataccattgtgaagtcatcgatgaaaaagtc
cagcatattgattggactccttcttgtcctgagccagtgtatatcccaacgggcttagaa
acggaacccctttatccagactccaaggaagctactgtggtttatctagctgaagatgct
tacaaagagccctgttttgtgtattcccgagttgggggtaaccgaacacctttgaagcag
cctgtggattaccgtgacaatactttgatgtttgaagcaaggtttgagagtggtaatcta
cagaaggtagtcaaagtggcagaatacgaataccaattgactgtacgccctgacctcttc
acaaataaacacacccagtggtactatttccaagtcactaatatgcgagcaggaatagtc
tacagattcactattgtcaacttcaccaaacctgctagtctttacagtcggggtatgcgc
ccactgttctattctgaaaaagaggccaaggctcatcacattggctggcagagaatagga
gaccaaatcaagtattataggaacaacccaggccaagatgggcgccattatttctctctt
acatggacatttcaatttccacacaacaaagatacctgctactttgctcattgctatcca
tacacttacaccaacctgcaagaatacctttctggcatcaataatgatccagtacggtca
aagttttgtaaaatacgtgttttgtgccacacgcttgctaggaacatggtgtatatttta
acaatcactacccccttgaagaactctgactcaagaaagcggaaggctgtgattctgact
gcaagggtccatccaggggaaaccaacagctcttggatcatgaaaggcttcctagattat
attttaggaaactcaagtgatgcacagttgcttcgggacacttttgtcttcaaggtggta
cccatgctcaatccagatggtgtgattgtgggaaattatcgctgttccttagctggacgg
gatttaaaccgtaattatacatctctcctgaaggaatcttttccttctgtatggtatacc
cggaacatggttcatagactgatggagaaacgagaggttattttatactgtgatcttcat
ggccatagtaggaaagagaacatcttcatgtatggctgtgatggtagtgacagatctaag
acattatacttacagcaacgaatcttcccacttatgctaagcaaaaattgtccagataaa
ttttcattctcagcttgcaagtttaatgtccagaagagcaaagaaggaacaggaagggtg
gtaatgtggaaaatgggaatcaggaacagctttaccatggaggccaccttctgtggatct
actctgggtaacaaacgaggcactcatttcagcacgaaagacctggaatcaatgggatat
catttttgtgattctctcttggattattgtgatcccgaccggaccaagtattatcggtgc
ctgaaagaattagaagaaatggaaagacatataaccctggaaaaagtctttgaggattca
gacacacctgtgatagacattacattggatgtagagtctagtagccgaggctctgacagt
tcagaatccattgactctctgacttaccttctcaagttaacttctcagaaaaaacatttg
aaaacaaagaaggaaaggaattctaccatagcaagccaccaaaatgccagaggacaagag
gtttatgatagagggcatttgctgcaaagacacacacaatcaaattctgatgtgaaagat
acaaggccaaatgaaccagatgattatatggttgattatttcagaagacaattacctaat
caaggtttggatctgcaccacaacttaaaaagcaaaataaaagaatgcatatctttccaa
agcaagaagactggcataaattggacagatgatgaaaaaagaagctacaaggataaagga
atagttcaaactcaagaaatattgcagtatttgctccccatcgtgcatagcactaaaaac
atgcaaaccactcagataaaacagctattcaatccaagaaccaacttccaaatccaacat
caactaaatccggctacttgcagaaatataaagaaatacagcacatcttggacagcaccc
agaaatcacccttttgtaatccaaggggatgttatggcaaactcttcagaatgggtccag
tctaagccccacaggtcattggaaagtttatcacctctcaaaggccccaagaagaataaa
cattctcaaatctgggccataaagaatgaagacataaaacctctcagcagcaagtgggag
actgcttcttcaagctttggaatggatgcaaatgttctaaaatataagagtcttcaagct
gaagaaactaaccagcaaagctctaagcatacagccctccatctaactaaaaataaggat
gagcaggccaataagaatgatggacaacccaccttatatctgaagttccaaagggagagt
taa

DBGET integrated database retrieval system