KEGG   Homo sapiens (human): 341116Help
Entry
341116            CDS       T01001                                 

Gene name
MS4A10, CD20L7, MS4A9
Definition
(RefSeq) membrane spanning 4-domains A10
  KO
K22189  membrane-spanning 4-domains subfamily A member 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    341116 (MS4A10)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   341116 (MS4A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20 FPN1
Motif
Other DBs
NCBI-GeneID: 341116
NCBI-ProteinID: NP_996776
OMIM: 608403
HGNC: 13368
Ensembl: ENSG00000172689
Vega: OTTHUMG00000167689
Pharos: Q96PG2(Tdark)
UniProt: Q96PG2
Position
11q12.2
AA seq 267 aa AA seqDB search
MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKEL
GAFHITIALLHLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYL
KMLCLMTNLISLFCVLSGLFVISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVL
ELFLPVPTAVTAWRGDCPSAKNDDACLVPNTPLHLKGLPVEPPPSYQSVIQGDAQHKQHQ
RLREVKQVAPDTWIVTDGAAIWTQTAN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagaagccacagttattcccagccgttgtgctagggggctcccatcatggcaa
gtcctcagcccagtccagccctggcagacaagtgcaccccagaacacgacccagcccaag
ctcctggctccacaccagcacgagaagtcccagaagaagagcagccttcttaaggagctg
ggggccttccacatcaccatcgctctgctgcacctggtctttgggggctacctggcctct
atagtcaagaaccttcacctggtggtgctgaagtcttggtatccattctggggggctgcc
tcttttctcatttcagggatcttggcgataacaatgaagaccttttctaaaacttacctg
aagatgttgtgcctgatgacaaacctcatcagcctcttttgcgtgctgtctggcctcttc
gtcatctccaaggatctctttctggagagcccatttgagtccccgatctggagaatgtac
cccaactccacggtccacatccagaggctggagctggccttgctctgcttcactgtccta
gagctcttcctgccagtgcccacagctgtcacagcctggagaggggactgcccatctgca
aagaatgatgatgcatgccttgttccgaatacaccattgcatctcaaaggcctgccggtg
gagcccccgccatcctaccagagtgtgattcaaggcgacgcacaacacaagcaacatcag
aggctcagagaagttaagcaagttgccccggacacatggatagtcactgacggagctgcg
atctggacccagactgcaaactga

DBGET integrated database retrieval system