KEGG   Homo sapiens (human): 341392Help
Entry
341392            CDS       T01001                                 

Gene name
ACSM4
Definition
(RefSeq) acyl-CoA synthetase medium chain family member 4
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    341392 (ACSM4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  butyrate---CoA ligase
     341392 (ACSM4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   341392 (ACSM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C UFC1
Motif
Other DBs
NCBI-GeneID: 341392
NCBI-ProteinID: NP_001073923
OMIM: 614360
HGNC: 32016
Ensembl: ENSG00000215009
Vega: OTTHUMG00000154975
Pharos: P0C7M7(Tdark)
UniProt: P0C7M7
Position
12p13.31
AA seq 580 aa AA seqDB search
MKIFFRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADVLD
QWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPCGLQRGDRLAVI
LPRIPEWWLVNVACIRTGIIFMPGTIQLTAKDILYRLRASKAKCIVASEEVAPAVESIVL
ECPDLKTKLLVSPQSWNGWLSFQELFQFASEEHSCVETGSQEPMTIYFTSGTTGFPKMAQ
HSQSSLGIGFTLCGRYWLDLKSSDIIWNMSDTGWVKAAIGSVFSSWLCGACVFVHRMAQF
DTDTFLDTLTTYPITTLCSPPTVYRMLVQKDLKRYKFKSLRHCLTGGEPLNPEVLEQWRV
QTGLELYEGYGQTEVGMICANQKGQEIKPGSMGKGMLPYDVQIIDENGNVLPPGKEGEIA
LRLKPTRPFCFFSKYVDNPQKTAATIRGDFYVTGDRGVMDSDGYFWFVGRADDVIISSGY
RIGPFEVESALIEHPAVVESAVVSSPDQIRGEVVKAFVVLAAPFKSYNPEKLTLELQDHV
KKSTAPYKYPRKVEFVQELPKTITGKIKRNVLRDQEWRGR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttttccgctaccagacatttagattcatctggctcaccaagccacctggc
cggcgcttacacaaagatcaccagctttggacgcctctgactcttgctgactttgaagcc
ataaatcgctgtaacaggccattgcctaaaaactttaactttgctgcagatgtgctggac
cagtggtcccaaaaggagaagacaggggagagaccagctaacccagccctgtggtgggtg
aatggcaaaggggatgaggtaaaatggagcttcagagaactgggctccttgtcccgaaaa
gctgccaacgtgctcaccaagccctgtggcctgcagagaggagaccgtttggccgtgatt
ctgcccagaatccctgagtggtggctggtcaatgtagcttgcatacgaacagggatcatc
ttcatgccgggaacaatccagctgacagcaaaagacatcctctaccggctgcgagcatcc
aaggccaagtgcattgtggccagtgaggaggtggccccagcggtggagtccattgtattg
gagtgtcctgaccttaagacaaaactcctggtgtctccacaaagctggaatgggtggctc
agcttccaggagttatttcaattcgcctctgaagagcacagctgtgtggaaacaggaagt
caagaaccaatgaccatttatttcaccagtgggaccacaggctttcctaaaatggcccag
cactctcagagcagcctcggcattgggttcaccctctgcggaaggtattggctggacttg
aagtcctcagatatcatatggaatatgtctgacacgggctgggtcaaggccgccattggc
agtgtgttttcttcctggctgtgtggagcctgtgtttttgtgcatcgaatggcacagttt
gacactgacaccttcctagacacacttactacttatcccatcacgaccctgtgcagtcct
cccactgtgtaccggatgctcgtgcaaaaagaccttaagagatataaattcaagagtctg
cggcactgcttgaccggaggggagccactcaacccagaagtgctggagcagtggagggtg
caaactgggctggagctatatgagggctatggacagacggaagtgggaatgatttgtgcc
aatcagaaaggccaagaaattaaaccaggttcaatggggaaaggaatgctgccctatgat
gtccagattatagatgaaaatggcaatgttctaccacctggcaaagaaggggaaattgcc
ctcagactcaaacctacacggcccttctgtttcttctctaaatatgtggacaatccacag
aaaactgctgccacgataagaggagatttttatgtcactggagacagaggagtgatggac
agtgatgggtatttctggtttgtcggcagagctgatgatgtcattatatcctctgggtac
cgtattgggccatttgaagtggagagtgcactcattgagcatccagcagttgttgaatcg
gctgttgtcagtagtccagatcaaatccgcggagaggtggtgaaagcttttgttgtctta
gctgcaccctttaagtcctacaacccagagaaattaactcttgaacttcaggatcatgtg
aaaaaatcaactgcaccttacaaatatccaagaaaggtggaatttgttcaagaactccca
aagacaatcactgggaaaatcaaacgcaacgttttaagagaccaagaatggagaggaaga
tag

DBGET integrated database retrieval system