KEGG   Homo sapiens (human): 341416Help
Entry
341416            CDS       T01001                                 

Gene name
OR6C2, OR6C67
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    341416 (OR6C2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    341416 (OR6C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 341416
NCBI-ProteinID: NP_473446
HGNC: 15436
Ensembl: ENSG00000179695
Vega: OTTHUMG00000169957
Pharos: Q9NZP2(Tdark)
UniProt: Q9NZP2 A0A126GW05
Position
12q13.2
AA seq 312 aa AA seqDB search
MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR
YVAICKPLHYVVIMNNRVCTLLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAG
PLLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRTILKFPSVQQRKKAFSTCS
SHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS
DSIKRIAFLSKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccacacagtaataagaacttttatcctgctgggactgacaggtgacccacac
ctgcaagttctgctttttatctttctatttctcacctacatgttgagtgtaacagggaac
ctgactattatcaccctcacattggtggaccaccaccttaaaactcctatgtacttcttt
ctcagaaatttttccttcttagaagtctcatttactacagtctgcattcccagattcttg
tacaatatatcaatgggggacaataccattacctacaatgcttgtgccagtcaaatattc
tttgttattctctttggagcaacagaattttttctcttggcagccatgtcctatgaccgc
tatgtggccatctgtaaaccccttcattatgtggtcatcatgaacaacagggtgtgtacc
ttattagttctctgctgttgggtggctggcttgatgatcattgttccaccacttagctta
ggcctccagctcgaattctgtgactccaatgccattgatcattttagctgtgatgcaggt
cctctcctaaagatctcatgctcagatacatgggtaatagaacagatggttatacttatg
gctgtatttgcactcattatcaccctagtttgtgtgattctgtcctacttgtacatagtc
agaacaattctgaagttcccttctgttcagcaaaggaaaaaggccttttctacctgttca
tcccacatgattgtggtttccattgcctatggaagctgcatcttcatctatatcaagccc
tctgcaaaagatgaggtggccataaataaaggagtttcagttcttactacttctgtcgca
cccttgttgaaccccttcatttacaccttgaggaacaagcaagtgaaacaagctttcagt
gactctataaagaggattgcatttctctcaaagaagtag

DBGET integrated database retrieval system