KEGG   Homo sapiens (human): 341880
Entry
341880            CDS       T01001                                 
Symbol
SLC35F4, C14orf36, c14_5373
Name
(RefSeq) solute carrier family 35 member F4
  KO
K15288  solute carrier family 35, member F3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    341880 (SLC35F4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   341880 (SLC35F4)
SSDB
Motif
Pfam: SLC35F EamA
Other DBs
NCBI-GeneID: 341880
NCBI-ProteinID: NP_001293016
HGNC: 19845
Ensembl: ENSG00000151812
Vega: OTTHUMG00000171317
Pharos: A4IF30(Tdark)
UniProt: A4IF30 G3V4Z9
Position
14:complement(57563920..57983181)
AA seq 485 aa
MDVKAAPNGVATIEDRILRITGYYGYYPGYSSQKSTSRSSVTRCKPGANCPSSHSGISRQ
LSPLSVTEDSSAPILELQNQGSSGVCGHRVERQNRSADDGTQTHSENSSQENRIKARCLS
CTSMVLKGIWGLLIILSVSSSWVGTTQIVKITYKNFYCPFFMTWFSTNWNIMFFPVYYSG
HLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTAT
DVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFA
VGSASTSALYKVLFKMFLGSANFGEAAHFVSTLGFFNLIFISFTPVILYFTKVEHWSSFA
ALPWGCLCGMAGLWLAFNILVNVGVVLTYPILISIGTVLSVPGNAAVDLLKQEVIFNVVR
LAATIIICIGFLLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTV
SIPLA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggatgtcaaggcggcccccaacggggtggccactatcgaggaccggatcctgcggatc
accggctactatggctattatccaggttactccagccagaaaagtacctccagatcatca
gtcactagatgtaaaccaggagccaactgccccagttcacacagtggcatcagtagacaa
ctgtccccactgtctgtcaccgaagattcctctgctcctattcttgaacttcaaaaccaa
ggatcctcaggagtttgtggacacagagttgagagacagaacagatcagcagacgatggg
acacagactcattctgagaacagcagccaagaaaacagaatcaaggctcgctgcctgtcc
tgcacgtccatggttctgaagggcatctggggactcttgatcatcttgtcagtatcatca
tcttgggttggaactacacagattgtaaaaattacttataagaacttctattgcccattt
ttcatgacttggttttcaacaaactggaacattatgtttttcccagtctattattctggt
catctagccactgctcaagaaaagcaatctccaatgaaaaaattcagggaatgcagtcgg
atttttggtgaagatggtctgacgctgaaactctttcttaaaagaactgctcccttttct
attctatggactttgactaattacctttatttactggctttaaagaagctgacggccacg
gatgtctccgctctgttctgttgtaacaaagcctttgtcttcttgctgtcatggattgtg
ctgaaagacaggttcatgggagtgaggatagttgctgcaataatggcaattaccggcatt
gtcatgatggcatatgcagataatttccacgctgattccatcataggagtggcatttgcg
gtgggctcagcctctacatctgcattatataaggtcttgtttaaaatgtttcttggaagt
gccaactttggggaagctgcacactttgtctccaccttgggtttcttcaatttgatcttc
atctccttcaccccagtcatcttgtatttcaccaaggtggagcactggtcctcttttgct
gctctgccatggggctgtctctgtgggatggcagggctgtggctggccttcaacatcctg
gtgaatgttggggtggtgctgacatacccaatcctaatctccattgggacagtgctcagc
gttcctggaaatgcagctgtggatctcctaaagcaggaggtgatattcaatgttgtccgc
ctggctgctaccatcatcatctgcattgggtttctgctgatgctgttgcctgaggaatgg
gatgaaatcaccctgaggttcatcaacagcctgaaggaaaagaagagtgaggagcatgtg
gatgatgtgactgatcccagcatacacctgcggggcagaggcagagccaatgggacagtg
tctataccactggcttag

DBGET integrated database retrieval system