KEGG   Homo sapiens (human): 3419Help
Entry
3419              CDS       T01001                                 

Gene name
IDH3A
Definition
(RefSeq) isocitrate dehydrogenase 3 (NAD(+)) alpha
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3419 (IDH3A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     3419 (IDH3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 3419
NCBI-ProteinID: NP_005521
OMIM: 601149
HGNC: 5384
Ensembl: ENSG00000166411
Vega: OTTHUMG00000143732
Pharos: P50213(Tbio)
UniProt: P50213
Structure
PDB: 

Position
15q25.1
AA seq 366 aa AA seqDB search
MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAP
IQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL
YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIA
EFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV
QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD
MANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR
RVKDLD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcccgcgtggatctctaaggtctctcggctgctgggggcattccacaaccca
aaacaggtgaccagaggttttactggtggtgttcagacagtaactttaattccaggagat
ggtattggcccagaaatttcagctgcagttatgaagatttttgatgctgccaaagcacct
attcagtgggaggagcggaacgtcactgccattcaaggacctggaggaaagtggatgatc
ccttcagaggctaaagagtccatggataagaacaagatgggcttgaaaggccctttgaag
accccaatagcagccggtcacccatctatgaatttactgctgcgcaaaacatttgacctt
tacgcgaatgtccgaccatgtgtctctatcgaaggctataaaaccccttacaccgatgta
aatattgtgaccattcgagagaacacagaaggagaatacagtggaattgagcatgtgatt
gttgatggagtcgtgcagagtatcaagctcatcaccgagggggcgagcaagcgcattgct
gagtttgcctttgagtatgcccggaacaaccaccggagcaacgtcacggcggtgcacaaa
gccaacatcatgcggatgtcagatgggctttttctacaaaaatgcagggaagttgcagaa
agctgtaaagatattaaatttaatgagatgtaccttgatacagtatgtttgaatatggta
caagatccttcccaatttgatgttcttgttatgccaaatttgtatggagacatccttagt
gacttgtgtgcaggattgatcggaggtctcggtgtgacaccaagtggcaacattggagcc
aatggggttgcaatttttgagtcggttcatgggacggctccagacattgcaggcaaggac
atggcgaatcccacagccctcctgctcagtgccgtgatgatgctgcgccacatgggactt
tttgaccatgctgcaagaattgaggctgcgtgttttgctacaattaaggacggaaagagc
ttgacaaaagatttgggaggcaatgcaaaatgctcagacttcacagaggaaatctgtcgc
cgagtaaaagatttagattaa

DBGET integrated database retrieval system