KEGG   Homo sapiens (human): 3420Help
Entry
3420              CDS       T01001                                 

Gene name
IDH3B, RP46
Definition
(RefSeq) isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit beta
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3420 (IDH3B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     3420 (IDH3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh AAA_3
Motif
Other DBs
NCBI-GeneID: 3420
NCBI-ProteinID: NP_008830
OMIM: 604526
HGNC: 5385
Ensembl: ENSG00000101365
Vega: OTTHUMG00000031699
Pharos: O43837(Tbio)
UniProt: O43837
Structure
PDB: 

Position
20p13
AA seq 385 aa AA seqDB search
MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVG
PELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
YKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESAR
GVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELY
PKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRT
RDMGGYSTTTDFIKSVIGHLQTKGS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattgagcggagtccgctggctgacccgagcgctggtctccgccgggaaccct
ggggcatggagaggtctgagtacctcggccgcggcgcacgctgcatcgcggagccaggcc
gaggacgtgagggtggagggctcctttcccgtgaccatgcttccgggagacggtgtgggg
cctgagctgatgcacgccgtcaaggaggtgttcaaggctgccgctgtcccagtggagttc
caggagcaccacctgagtgaggtgcagaatatggcatctgaggagaagctggagcaggtg
ctgagttccatgaaggagaacaaagtggccatcattggaaagattcataccccgatggag
tataagggggagctagcctcctatgatatgcggctgaggcgtaagttggacttatttgcc
aacgtagtccatgtgaagtcacttcctgggtatatgactcggcacaacaatctagacctg
gtgatcattcgagagcagacagaaggggagtacagctctctggaacatgagagtgcaagg
ggtgtgattgagtgtttgaagattgtcacacgagccaagtctcagcggattgcaaagttc
gcctttgactatgccaccaagaaggggcggggcaaggtcactgctgtccacaaggccaac
atcatgaaacttggggatgggttgttcctgcagtgctgtgaggaagttgctgaactgtac
cccaaaatcaaatttgagacaatgatcatagacaactgctgcatgcagctggtgcagaat
ccttaccagtttgatgtgcttgtgatgcccaatctctatgggaacattattgacaatctg
gctgctggcctggttgggggagctggtgtggtccctggtgagagctatagtgcagaatac
gcagtctttgagacgggtgcccggcacccatttgcccaggcagtgggcaggaatatagcc
aatcccacggccatgctgctgtcggcttccaacatgctgcggcatcttaatcttgagtat
cactccagcatgatcgcagatgcggtgaagaaggtgatcaaagttggcaaggtgcggact
cgagacatgggcggctacagcaccacaaccgacttcatcaagtctgtcatcggtcacctg
cagactaaagggagctag

DBGET integrated database retrieval system