KEGG   Homo sapiens (human): 3421Help
Entry
3421              CDS       T01001                                 

Gene name
IDH3G, H-IDHG
Definition
(RefSeq) isocitrate dehydrogenase 3 (NAD(+)) gamma
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3421 (IDH3G)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     3421 (IDH3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 3421
NCBI-ProteinID: NP_004126
OMIM: 300089
HGNC: 5386
Ensembl: ENSG00000067829
Vega: OTTHUMG00000024219
Pharos: P51553(Tbio)
UniProt: P51553
Structure
PDB: 

Position
Xq28
AA seq 393 aa AA seqDB search
MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMI
PGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET
NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHE
SVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA
ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG
HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNEN
MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggtagcgaccgtcgccggcagcgccgcgaaggcggtgctcgggccagcc
cttctctgccgtccctgggaggttctaggcgcccacgaggtcccctcgaggaacatcttt
tcagaacaaacaattcctccgtccgctaagtatggcgggcggcacacggtgaccatgatc
ccaggggatggcatcgggccagagctcatgctgcatgtcaagtccgtcttcaggcacgca
tgtgtaccagtggactttgaagaggtgcacgtgagttccaatgctgatgaagaggacatt
cgcaatgccatcatggccatccgccggaaccgcgtggccctgaagggcaacatcgaaacc
aaccataacctgccaccgtcgcacaaatctcgaaacaacatccttcgcaccagcctggac
ctctatgccaacgtcatccactgtaagagccttccaggcgtggtgacccggcacaaggac
atagacatcctcattgtccgggagaacacagagggcgagtacagcagcctggagcatgag
agtgtggcgggagtggtggagagcctgaagatcatcaccaaggccaagtccctgcgcatt
gccgagtatgccttcaagctggcgcaggagagcgggcgcaagaaagtgacggccgtgcac
aaggccaacatcatgaaactgggcgatgggcttttcctccagtgctgcagggaggtggca
gcccgctaccctcagatcaccttcgagaacatgattgtggataacaccaccatgcagctg
gtgtcccggccccagcagtttgatgtcatggtgatgcccaatctctatggcaacatcgtc
aacaatgtctgcgcgggactggtcgggggcccaggccttgtggctggggccaactatggc
catgtgtacgcggtgtttgaaacagctacgaggaacaccggcaagagtatcgccaataag
aacatcgccaaccccacggccaccctgctggccagctgcatgatgctggaccacctcaag
ctgcactcctatgccacctccatccgtaaggctgtcctggcatccatggacaatgagaat
atgcacactccggacatcgggggccagggcacaacatctgaagccatccaggacgtcatc
cgccacatccgcgtcatcaacggccgggccgtggaggcctag

DBGET integrated database retrieval system