KEGG   Homo sapiens (human): 342132Help
Entry
342132            CDS       T01001                                 

Gene name
ZNF774
Definition
(RefSeq) zinc finger protein 774
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 XPA_N zinc_ribbon_15 zf-met C1_4 Zn_Tnp_IS1595 zf-LYAR HypA zf-Di19 zf-C2HC_2
Motif
Other DBs
NCBI-GeneID: 342132
NCBI-ProteinID: NP_001004309
HGNC: 33108
Ensembl: ENSG00000196391
Vega: OTTHUMG00000172359
Pharos: Q6NX45(Tdark)
UniProt: Q6NX45
Position
15q26.1
AA seq 483 aa AA seqDB search
MWLGTSGKSGLPGHCLENPLQECHPAQLEEWALKGISRPSVISQPEQKEEPWVLPLQNFE
ARKIPRESHTDCEHQVAKLNQDNSETAEQCGTSSERTNKDLSHTLSWGGNWEQGLELEGQ
HGTLPGEGQLESFSQERDLNKLLDGYVGEKPMCAECGKSFNQSSYLIRHLRTHTGERPYT
CIECGKGFKQSSDLVTHRRTHTGEKPYQCKGCEKKFSDSSTLIKHQRTHTGERPYECPEC
GKTFGRKPHLIMHQRTHTGEKPYACLECHKSFSRSSNFITHQRTHTGVKPYRCNDCGESF
SQSSDLIKHQRTHTGERPFKCPECGKGFRDSSHFVAHMSTHSGERPFSCPDCHKSFSQSS
HLVTHQRTHTGERPFKCENCGKGFADSSALIKHQRIHTGERPYKCGECGKSFNQSSHFIT
HQRIHLGDRPYRCPECGKTFNQRSHFLTHQRTHTGEKPFHCSKCNKSFRQKAHLLCHQNT
HLI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtggctggggacttcagggaagagtgggttacctggacactgcttagagaatcctctc
caggaatgccacccagcacagttagaagaatgggctctcaaaggaatttccaggcctagt
gtaatctcccagccggagcagaaagaagagccatgggtcctaccactccaaaactttgag
gcgaggaagatcccgagggaaagccacacagactgtgagcatcaggtggcaaagctcaat
caggacaattctgaaacagcagaacaatgtggaacatcctcagaaaggaccaataaagat
ctttctcatactcttagttggggaggaaactgggagcaaggcctagaattagaagggcaa
catggaacccttccaggagagggccagctggagtccttttcacaggagagggatttaaac
aagctcctggatggatatgtaggagagaagcctatgtgtgcagaatgcgggaaaagcttt
aaccagagttcctatctcataagacacctaagaacccacactggcgagaggccctatacg
tgcattgagtgtgggaaaggcttcaaacagagctcagaccttgtcacccatcgcagaaca
cacacaggagagaagccctaccaatgcaaggggtgtgagaagaaattcagcgacagctca
acactcatcaaacatcagagaacccacacaggggagagaccctatgagtgcccagagtgt
ggaaagacttttgggcggaagccacacctcataatgcaccaaagaacccacacaggcgag
aagccctacgcgtgcctggaatgtcacaaaagcttcagtcgaagctcaaatttcatcact
caccagaggacccacacaggggtgaagccttacaggtgtaatgactgtggggagagtttt
agccagagctcggatttgattaagcaccaacgaacccacacgggagaacggcccttcaaa
tgcccggagtgcgggaagggcttcagagatagttctcattttgtagctcacatgagcact
cattcaggagagaggcctttcagttgtcctgactgccacaaaagcttcagtcagagctca
catttggtcacgcaccaaagaacacacacaggtgagagaccttttaagtgcgaaaactgt
gggaaaggattcgccgacagctccgccctcattaagcaccaacgaatccacaccggagaa
agaccctacaaatgtggagagtgtgggaagagcttcaatcagagctcccactttattacc
catcagcgaatccacttaggagacaggccctatcgatgtcctgagtgtggcaagaccttc
aatcagcgttcccatttcctcacacaccagagaacgcatacaggagaaaaacctttccac
tgtagtaaatgtaacaagagcttccgtcagaaagcgcatcttttatgccatcaaaacacc
catttgatttag

DBGET integrated database retrieval system