KEGG   Homo sapiens (human): 342184Help
Entry
342184            CDS       T01001                                 

Gene name
FMN1, FMN, LD
Definition
(RefSeq) formin 1
  KO
K10367  formin 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    342184 (FMN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     342184 (FMN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FH2
Motif
Other DBs
NCBI-GeneID: 342184
NCBI-ProteinID: NP_001264242
OMIM: 136535
HGNC: 3768
Ensembl: ENSG00000248905
Vega: OTTHUMG00000172201
Pharos: Q68DA7(Tbio)
UniProt: Q68DA7
Position
15q13.3
AA seq 1419 aa AA seqDB search
MEGTHCTLQLHKPITELCYISFCLPKGEVRGFSYKGTVTLDRSNKGFHNCYQVREESDII
SLSQEPDEHPGDIFFKQTPTKDILTELYKLTTERERLLTNLLSSDHILGITMGNQEGKLQ
ELSVSLAPEDDCFQSAGDWQGELPVGPLNKRSTHGNKKPRRSSGRRESFGALPQKRTKRK
GRGGRESAPLMGKDKICSSHSLPLSRTRPNLWVLEEKGNLLPNGALACSLQRRESCPPDI
PKTPDTDLGFGSFETAFKDTGLGREVLPPDCSSTEAGGDGIRRPPSGLEHQQTGLSESHQ
DPEKHPEAEKDEMEKPAKRTCKQKPVSKVVAKVQDLSSQVQRVVKTHSKGKETIAIRPAA
HAEFVPKADLLTLPGAEAGAHGSRRQGKERQGDRSSQSPAGETASISSVSASAEGAVNKV
PLKVIESEKLDEAPEGKRLGFPVHTSVPHTRPETRNKRRAGLPLGGHKSLFLDLPHKVGP
DSSQPRGDKKKPSPPAPAALGKVFNNSASQSSTHKQTSPVPSPLSPRLPSPQQHHRILRL
PALPGEREAALNDSPCRKSRVFSGCVSADTLEPPSSAKVTETKGASPAFLRAGQPRLVPG
ETLEKSLGPGKTTAEPQHQSPPGISSEGFPWDGFNEQTPKDLPNRDGGAWVLGYRAGPAC
PFLLHEEREKSNRSELYLDLHPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYTEA
EYQAAILHLKREHKEEIENLQAQFELRAFHIRGEHAMITARLEETIENLKHELEHRWRGG
CEERKDVCISTDDDCPPKTFRNVCVQTDRETFLKPCESESKTTRSNQLVPKKLNISSLSQ
LSPPNDHKDIHAALQPMEGMASNQQKALPPPPASIPPPPPLPSGLGSLSPAPPMPPVSAG
PPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLF
FGLGSSSSQCPRKPAIEPSCPMKPLYWTRIQISDRSQNATPTLWDSLEEPDIRDPSEFEY
LFSKDTTQQKKKPLSETYEKKNKVKKIIKLLDGKRSQTVGILISSLHLEMKDIQQAIFNV
DDSVVDLETLAALYENRAQEDELVKIRKYYETSKEEELKLLDKPEQFLHELAQIPNFAER
AQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNYMNGGNRTRGQ
ADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDFFLASQ
VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESH
LENAQKSFETTVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIWKRESKNISKERLKM
AQESVSKLTSEKKVETKKINPTASLKERLRQKEASVTTN
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcactcattgtaccctccaattgcataagcccattacggaactctgctacatc
agcttctgtcttccaaagggggaagtcagaggattttcatacaagggcactgtaactcta
gacagatccaataaaggttttcataactgctaccaagtcagggaggagtcagacatcatc
agcctcagccaggagccggacgaacatccaggcgacatatttttcaagcagactcccacg
aaagacattctaactgagctgtacaaactcacaacagagagggagagactgctaaccaat
ctcctgagctcagaccacatcctggggatcacgatggggaaccaggaggggaagctgcaa
gagctgtccgtgagcctggcccccgaggatgactgtttccagagtgctggtgactggcag
ggagagctccccgtgggccctctcaataagaggagcacccacgggaacaaaaagcctcgg
aggtctagtggaaggagagagagctttggggcccttccacagaagaggaccaaaagaaaa
gggcgtggaggccgagaatcagctcctctgatgggcaaggacaagatctgttccagccac
tcccttcctctttctagaacaaggcctaacctttgggtactagaggagaaaggaaatctg
ctcccgaatggggcacttgcctgctccctgcagaggagagagagctgccccccagatatt
cccaagacgccagacacagaccttggctttgggagctttgagacggctttcaaggacact
gggcttggaagagaagtgctgccccctgactgcagctccacagaggcaggaggggatggc
attcggaggccgccgagcgggctggagcatcagcaaacaggtttgtctgaaagtcaccag
gaccctgagaagcatccagaggcagaaaaggatgagatggagaagccggctaagcggact
tgcaagcagaaacctgtctccaaagtggtggccaaagttcaggacctgtcctcccaggta
caaagagtagttaaaacgcattctaagggtaaggagacgattgccattcgcccagcagcc
cacgctgagtttgtacccaaagccgacttgctcaccctcccgggagctgaggctggggct
catggctccaggcggcagggcaaggagcggcaaggggataggtcatcgcagtcgccagcc
ggggaaacagcctccatttctagtgtgtcggccagtgccgagggggccgtgaacaaggtc
cccctgaaggtgatagagagtgagaagttagatgaagcccctgaggggaaaagactgggc
ttccctgtccacacgagtgtccctcacactcgcccagaaacgagaaacaagaggagagcc
gggttgccccttggtggccacaagtccttgtttctggatctgccccacaaagtaggtcct
gactcctcacaacccagaggtgataagaagaagccatccccaccagcaccggcagctctt
ggcaaggtgtttaataattcagcctcgcagtccagcacacacaaacagacgtcacctgtt
ccctcgcctctgtctccaaggctccccagccctcagcagcatcacaggatcctccggctc
cctgcattgcctggtgagagggaagctgctcttaatgactctccttgtagaaagagccgt
gtcttctctgggtgcgtctctgctgacaccttggagccaccatcctctgcaaaggtcacg
gagaccaaaggagccagcccggccttcctcagagcaggccaacctcggttggtgcctggg
gaaactttggaaaagagcttggggccagggaagaccacagctgagccccagcaccagtca
cctccaggtatctcctctgagggctttccctgggacggcttcaatgagcagacacctaaa
gaccttcccaacagagatggaggcgcgtgggttctgggctacagagcgggaccagcctgt
ccatttttgcttcatgaggaaagggagaagtcaaacaggagcgaattgtacttggatctc
catcctgaccacagcctgactgagcaggatgacaggactcctggcagacttcaagctgtc
tggccacccccaaagacaaaagacacagaagaaaaagtgggactgaagtacactgaagca
gaataccaagctgctattttacacttgaagagggagcacaaagaagaaattgaaaacctg
caggcacagtttgaacttcgggcatttcatatccggggcgagcatgcaatgataacagcg
agactagaagaaaccattgaaaatctgaaacacgagctagaacacagatggcgagggggt
tgtgaagagaggaaagatgtgtgcatttccaccgatgatgactgccctccaaagaccttc
agaaatgtgtgcgtccagacagacagagagaccttcctcaagccctgtgaaagtgaaagc
aagacaaccagaagtaatcaattagtacccaaaaagctgaatatctcctctttaagccag
ctctcacccccaaatgaccacaaagacatccatgcagcactccagccaatggagggcatg
gcatcaaatcagcagaaggcattgcctccgcctcccgcatccatccctccccctccgccc
ctcccctcaggacttggatctttgtctcccgcacctccaatgccacctgtgagtgctggg
ccaccgctaccacctccgcctcctccaccgccacctctacctccaccttcaagtgctgga
cctccaccacccccacccccacccccacttcctaactcccctgccccacccaaccctgga
gggcctcctcctgctccaccacccccaggacttgcacccccacctccccctggactcttc
tttggacttggctcttcttccagtcaatgtcctcgaaaaccagccatcgagcccagttgt
cccatgaagcctttatattggactaggatacaaataagtgataggagccaaaatgctaca
ccaaccttatgggactccttagaagaacctgacattcgggaccccagtgaatttgagtat
ttattctccaaagacacaactcaacagaagaaaaaacctctgtcagagacttatgagaag
aaaaacaaggtcaaaaagatcatcaaattgttggatggaaaacgatctcaaactgtggga
atcttgatatctagtttacatttagaaatgaaggatatccaacaggccattttcaatgtg
gatgactccgtggttgatctggagaccctggcagccttatatgaaaacagagcccaagag
gatgagctggttaaaataagaaagtattacgagacatccaaagaagaagaactgaagctg
ctggataaacctgagcaatttttacatgagttagcccagattcctaattttgctgaacgt
gcccagtgcataatcttcagatctgtcttttctgagggtatcacctccttgcacagaaag
gtagagatcatcacgcgagcttctaaggacttgctgcacgtgaagagcgtgaaggatatt
ttagctctcatcttggcttttggaaattatatgaatggaggaaataggactcggggacaa
gccgatggatatagcttagaaattctgcccaaactcaaggatgtcaaaagtcgggataat
gggattaatctggtggactacgttgttaagtattacctgcgttactatgatcaggaagct
ggaacagaaaagagtgttttccccttgccggaaccacaggatttctttctggcctcccaa
gtcaagtttgaagacctcataaaagatttgagaaaactgaagaggcaactagaagcaagt
gagaaacagatggtggtggtgtgcaaggagtccccaaaggagtatctccagcctttcaag
gacaaactagaggagttcttccaaaaagccaaaaaagagcataagatggaagaaagtcac
ttggagaatgcacagaaaagttttgaaacaacagtacgatattttgggatgaagccaaag
tctggtgagaaggagatcacacccagctacgtgtttatggtgtggtatgagttctgcagt
gacttcaagacaatttggaaacgggagagtaaaaacatatctaaagaaagattgaaaatg
gctcaggaatcagtcagcaagttgacttcagagaagaaagtggagacaaagaaaatcaat
cccactgctagcctgaaagaaagactgcgtcagaaggaagccagtgtgaccactaactaa

DBGET integrated database retrieval system