KEGG   Homo sapiens (human): 3422Help
Entry
3422              CDS       T01001                                 

Gene name
IDI1, IPP1, IPPI1
Definition
(RefSeq) isopentenyl-diphosphate delta isomerase 1
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
hsa_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3422 (IDI1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     3422 (IDI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX Isochorismatase
Motif
Other DBs
NCBI-GeneID: 3422
NCBI-ProteinID: NP_001304884
OMIM: 604055
HGNC: 5387
Ensembl: ENSG00000067064
Vega: OTTHUMG00000017536
Pharos: Q13907(Tbio)
UniProt: Q13907
Structure
PDB: 

Position
10p15.3
AA seq 228 aa AA seqDB search
MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLF
NTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIP
LEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEEL
KELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgaaataaacactaaccacctcgacaagcaacaggttcaactcctggcagag
atgtgtatccttattgatgaaaatgacaataaaattggagctgagaccaagaagaattgt
cacctgaacgagaacattgagaaaggattattgcatcgagcttttagtgtcttcttattc
aacaccgaaaataagcttctgctacagcaaagatcagatgctaagattacctttccaggt
tgttttacgaatacgtgttgtagtcatccattaagcaatccagccgagcttgaggaaagt
gacgcccttggagtgaggcgagcagcacagagacggctgaaagctgagctaggaattccc
ttggaagaggttcctccagaagaaattaattatttaacacgaattcactacaaagctcag
tctgatggtatctggggtgaacatgaaattgattacattttgttggtgaggaagaatgta
actttgaatccagatcccaatgagattaaaagctattgttatgtgtcaaaggaagaacta
aaagaacttctgaaaaaagcagccagtggtgaaattaagataacgccatggtttaaaatt
attgcagcgacttttctctttaaatggtgggataacttaaatcatttgaatcagtttgtt
gaccatgagaaaatatacagaatgtga

DBGET integrated database retrieval system