KEGG   Homo sapiens (human): 3423Help
Entry
3423              CDS       T01001                                 

Gene name
IDS, MPS2, SIDS
Definition
(RefSeq) iduronate 2-sulfatase
  KO
K01136  iduronate 2-sulfatase [EC:3.1.6.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00078  Heparan sulfate degradation
Disease
H00129  Mucopolysaccharidosis type II (MPS2)
H00421  Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    3423 (IDS)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    3423 (IDS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.13  iduronate-2-sulfatase
     3423 (IDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Phosphodiest DUF229
Motif
Other DBs
NCBI-GeneID: 3423
NCBI-ProteinID: NP_000193
OMIM: 300823
HGNC: 5389
Ensembl: ENSG00000010404
Vega: OTTHUMG00000022615
Pharos: P22304(Tbio)
UniProt: P22304
Structure
PDB: 

Position
Xq28
AA seq 550 aa AA seqDB search
MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVR
SPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIP
QYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHA
NLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQK
LYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSY
FASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLI
FYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKP
SLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQ
GGDLFQLLMP
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaccccggaccggccgaggccttctctggctgggtctggttctgagctccgtc
tgcgtcgccctcggatccgaaacgcaggccaactcgaccacagatgctctgaacgttctt
ctcatcatcgtggatgacctgcgcccctccctgggctgttatggggataagctggtgagg
tccccaaatattgaccaactggcatcccacagcctcctcttccagaatgcctttgcgcag
caagcagtgtgcgccccgagccgcgtttctttcctcactggcaggagacctgacaccacc
cgcctgtacgacttcaactcctactggagggtgcacgctggaaacttctccaccatcccc
cagtacttcaaggagaatggctatgtgaccatgtcggtgggaaaagtctttcaccctggg
atatcttctaaccataccgatgattctccgtatagctggtcttttccaccttatcatcct
tcctctgagaagtatgaaaacactaagacatgtcgagggccagatggagaactccatgcc
aacctgctttgccctgtggatgtgctggatgttcccgagggcaccttgcctgacaaacag
agcactgagcaagccatacagttgttggaaaagatgaaaacgtcagccagtcctttcttc
ctggccgttgggtatcataagccacacatccccttcagataccccaaggaatttcagaag
ttgtatcccttggagaacatcaccctggcccccgatcccgaggtccctgatggcctaccc
cctgtggcctacaacccctggatggacatcaggcaacgggaagacgtccaagccttaaac
atcagtgtgccgtatggtccaattcctgtggactttcagcggaaaatccgccagagctac
tttgcctctgtgtcatatttggatacacaggtcggccgcctcttgagtgctttggacgat
cttcagctggccaacagcaccatcattgcatttacctcggatcatgggtgggctctaggt
gaacatggagaatgggccaaatacagcaattttgatgttgctacccatgttcccctgata
ttctatgttcctggaaggacggcttcacttccggaggcaggcgagaagcttttcccttac
ctcgacccttttgattccgcctcacagttgatggagccaggcaggcaatccatggacctt
gtggaacttgtgtctctttttcccacgctggctggacttgcaggactgcaggttccacct
cgctgccccgttccttcatttcacgttgagctgtgcagagaaggcaagaaccttctgaag
cattttcgattccgtgacttggaagaggatccgtacctccctggtaatccccgtgaactg
attgcctatagccagtatccccggccttcagacatccctcagtggaattctgacaagccg
agtttaaaagatataaagatcatgggctattccatacgcaccatagactataggtatact
gtgtgggttggcttcaatcctgatgaatttctagctaacttttctgacatccatgcaggg
gaactgtattttgtggattctgacccattgcaggatcacaatatgtataatgattcccaa
ggtggagatcttttccagttgttgatgccttga

DBGET integrated database retrieval system