KEGG   Homo sapiens (human): 342372Help
Entry
342372            CDS       T01001                                 

Gene name
PKD1L3
Definition
(RefSeq) polycystin 1 like 3, transient receptor potential channel interacting
  KO
K04989  polycystin 1L3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    342372 (PKD1L3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    342372 (PKD1L3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   342372 (PKD1L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel PLAT Ion_trans GPS Lectin_C
Motif
Other DBs
NCBI-GeneID: 342372
NCBI-ProteinID: NP_853514
OMIM: 607895
HGNC: 21716
Ensembl: ENSG00000277481
Vega: OTTHUMG00000166114
Pharos: Q7Z443(Tbio)
UniProt: Q7Z443
Position
16q22.2
AA seq 1732 aa AA seqDB search
MFFKGGSWLWLYIRTSIILGSELNSPAPHGQNNCYQLNRFQCSFEEAQHYCHVQRGFLAH
IWNKEVQDLIRDYLEEGKKWWIGQNVMPLKKHQDNKYPADVAANGPPKPLSCTYLSRNFI
RISSKGDKCLLKYYFICQTGDFLDGDAHYERNGNNSHLYQRHKKTKRGVAIARDKMPPGP
GHLPTTCHYPLPAHLSKTLCHPISQFPSVLSSITSQVTSAASEPSSQPLPVITQLTMPVS
VTHAGQSLAETTSSPKEEGHPNTFTSYLQVSLQKASGQVIDEIAGNFSRAVHGLQALNKL
QEACEFLQKLTALTPRFSKPAQVNLINSLIYLSEELLRIPFQNNNSLGFKVPPTVCPFHS
LNNVTKAGEGSWLESKRHTEPVEDILEMSLVEFGNIGEAFLEQNQSPESSVTLTSANATL
LLSRQNISTLPLSSYTLGHPAPVRLGFPSALALKELLNKHPGVNVQITGLAFNPFKDLDN
RNIVGSIGSVLLSANRKLLQVHDLMEDIEIMLWRNVSLETHPTSLNMSTHQLTITVNVTS
LEKSLIVSIDPDSPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLNPEHLQ
HGIGTYYITAVLSERQEGAQQTPSLVSVITAVTQCYYWEIHNQTWSSAGCQVGPQSTILR
TQCLCNHLTFFASDFFVVPRTVNVEDTIKLFLRVTNNPVGVSLLASLLGFYVITVVWARK
KDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLC
DPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHF
LCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSIATRHPWNQF
TRVQRLSCCMTLLLCNMVINVMFWKINSTTAKRDEQMRPFAVAWSELLVSIHTAVILFPI
NLVIGRLFPLIEPQETLPLFPPIQASCLSDASVEPLSATMVVEELKETVRFLLRRNTYLL
SKCEQPPWSSWDITKLVKLLSSLVSSHLEGQGCHQQGERHWARVVPENHHHFCCYLHRVL
QRLKSHLGTLGLTQGHQSCDFLDAASQLQKLQELLETHILPTEQEPSREVTSFAILSSEE
GKKPISNGLSKWLTSVCWLLLGFTSLASAFFTALYSLELSKDQATSWMISIILSVLQNIF
ISQPVKVVFFTFLYSLMMSRMPRLNKENEQQTKRILALLAKCSSSVPGSRDKNNPVYVAP
AINSPTKHPERTLKKKKLFKLTGDILVQILFLTLLMTAIYSAKNSNRFYLHQAIWKTFSH
QFSEIKLLQDFYPWANHILLPSLYGDYRGKNAVLEPSHCKCGVQLIFQIPRTKTYEKVDE
GQLAFCDNGHTCGRPKSLFPGLHLRRFSYICSPRPMVLIPTDELHERLTSKNENGFSYIM
RGAFFTSLRLESFTSLQMSKKGCVWSIISQVIYYLLVCYYAFIQGCQLKQQKWRFFTGKR
NILDTSIILISFILLGLDMKSISLHKKNMARYRDDQDRFISFYEAVKVNSAATHLVGFPV
LLATVQLWNLLRHSPRLRVISRTLSRAWDEVVGFLLIILILLTGYAIAFNLLFGCSISDY
RTFFSSAVTVVGLLMGISHQEEVFALDPVLGTFLILTSVILMVLVVINLFVSAILMAFGK
ERKSLKKEAALIDTLLQKLSNLLGISWPQKTSSEQAATTAVGSDTEVLDELP
NT seq 5199 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaaaggaggaagctggctttggttatacatcagaacaagtattattctagga
agtgagctaaacagcccagcaccacatgggcaaaataattgttaccagcttaacagattt
caatgcagctttgaggaagcacagcattactgtcatgtgcagagaggattcctagctcat
atttggaacaaggaagttcaagatctcatccgggactatctggaagaaggaaagaagtgg
tggattgggcaaaatgtaatgccattgaaaaagcatcaagacaacaaatacccagcagac
gttgcagccaacgggcccccaaagcccctcagctgcacctacctgtccagaaacttcatt
cggatctcatccaaaggggacaagtgcttactgaaatactatttcatttgccagactggt
gactttttggacggagatgcccattatgaaagaaatggaaataattcccatttgtaccag
agacacaagaagacaaaaagaggagttgcaatagcaagagacaaaatgcccccaggacct
ggtcatcttccaaccacatgtcactatcctcttcctgctcatctttccaagaccctgtgt
catcccatcagccagtttccttcagtactatcaagtatcacatcacaggtaacatcagcc
gcatctgaacccagcagccagcctctccctgtgataacacagctcaccatgcccgtgtct
gtcacgcatgctgggcaatctctggcagaaacaacttcaagcccaaaggaagaaggtcat
ccgaataccttcacctcttatctacaagtgtcattgcagaaggcatctggtcaggtcata
gatgagatagcagggaacttcagcagagcagttcatggtttgcaagctcttaacaaacta
caggaagcttgtgagttcctccagaaactaacagccttaaccccaagattttctaagcca
gctcaggttaatctcatcaattcccttatttacctgagtgaggagttactcaggatccca
tttcagaacaacaacagtctgggcttcaaagttcctccaactgtctgcccctttcattcc
ctcaacaatgtcaccaaagctggagaaggaagttggctggaatccaagcgtcatactgag
ccggtagaagacatcctggaaatgtccttggtggagtttgggaatatcggggaagcattt
ctagagcagaaccagtctcccgagtcttcagtgactttgacctctgccaatgctactctg
ctgctgagcagacaaaacatatcaactttaccgctgagctcttacactctgggtcaccca
gcccctgtgaggctaggctttccgtcggctttagctttgaaggagctcttgaataaacat
ccaggagttaatgtccaaataacaggactagctttcaatcccttcaaggatttggacaac
agaaacattgttggaagcattggaagtgtgttactaagcgctaatcgtaaattgctccaa
gtccatgatttaatggaggacattgagatcatgctctggagaaatgttagcttggaaacc
catcccaccagcctcaacatgagcacacatcagcttacaatcacagtgaacgtcacttcc
ttggagaaatccttgatagtgagcatagatcctgacagtccccttttaatgacactctac
ctggggttccagtatcagcctaactgcactcacttccacctgaacatcacccttccaaag
gataaggtgtggcaaaaagatgaggagtacacgtgggtgctgaatccagagcatctgcag
cacgggattggcacctactatataacagctgtgctgagtgagaggcaggagggtgctcag
cagacacccagcttggtctcggtcatcaccgccgtcactcagtgttactactgggagatc
cacaaccagacatggagcagcgccggatgccaagttgggccacagagcacaattctgagg
acacagtgtctctgtaaccacctgaccttctttgccagcgacttctttgtcgtgcccagg
accgtgaatgttgaagacacgatcaaactgttccttcgcgtgaccaacaatcctgttggg
gtgtcactgctggccagccttttaggattttatgtgatcacagttgtgtgggctcggaaa
aaggatcaagcagatatgcagaaggtgaaggtcactgtcctggctgataatgaccccagc
gctcaatttcactaccttattcaggtctacaccggatatcgaagaagcgctgctacaaca
gctaaggttgtcatcaccctctatggatcagagggacggagtgagccccatcacctctgt
gacccccagaagacagtctttgaacgagggggcctggatgtcttccttctcaccacttgg
acctctctagggaacctgcacagccttcggctctggcatgacaattctggcgtcagtccc
tcctggtatgtcagccaggtaattgtctgtgacatggcagttaagaggaagtggcatttc
ctgtgcaattgctggctggctgtggacctcggagactgtgagcttgaccgggtcttcatc
ccagtttcaaagagagagctcttttcctttagacatctgttttcctccatgattgtggaa
aagttcacccaggattatctgtggctttcaattgcaactcggcatccctggaaccagttt
acaagggtccaacggctgtcttgctgcatgacactgctactctgcaacatggtcatcaat
gttatgttctggaagataaacagcaccactgccaagagagatgagcaaatgcgtccattt
gctgtggcctggtctgaactgctggtcagcatccatactgctgtcatcctcttcccaatc
aatcttgtcatagggcggctcttcccgttgattgagccacaggagactctgcccctcttt
cctcccatccaggcctcctgcctctcagatgcttctgttgagcctctctctgccacaatg
gtagttgaggaattaaaggaaactgtgagattcctgctcaggagaaatacatacctactc
tccaagtgtgagcagccgccatggagttcttgggacattactaagctggtgaaactttta
tccagcctcgtatcatctcacttggagggtcaaggctgtcatcagcagggagagcgccac
tgggcacgtgttgttcctgaaaaccaccatcatttctgctgttacctgcatagagttctg
cagaggctgaaatctcacttaggcacgctgggtctcacccagggtcaccagtcctgtgac
ttcctagatgcagccagccaacttcaaaaactccaggaactcttggaaacacatattctt
cccacggagcaagagccatccagggaagtcaccagttttgccatcctgagctcagaagaa
ggaaaaaagcccatctcaaatggcctgtccaaatggttgacttcagtctgctggctcctc
ttaggtttcactagcctggcttcagccttttttacagcactttatagcttggaattgagc
aaagaccaagccaccagctggatgatttcaattattttatcagtgcttcagaacatcttc
atcagccagccagtaaaggtggtcttcttcacattcttatactcactgatgatgagcagg
atgccacggcttaacaaagagaatgaacaacaaacaaagaggatcttggcactcttggca
aaatgttcttcgtcagtaccaggttcaagagataagaacaaccccgtctatgtagcccca
gctataaatagtccaactaagcacccagaaagaaccttgaaaaagaagaaactcttcaag
ctgactggagatattttggtacaaatcctcttccttaccctgttgatgactgcaatctac
tctgcaaagaactccaatagattttacctccaccaagctatctggaagacattttcgcac
cagttctcggaaatcaaacttcttcaggatttctacccctgggccaatcatatccttctt
cctagcctgtatggggattacagaggtaagaatgcagtcctggagcccagtcattgcaaa
tgtggggtacaattaattttccaaataccccgtaccaagacctatgagaaagtggacgaa
ggtcagctggcgttttgtgataacggccatacctgtgggcgtcccaagagcctattccct
ggacttcatctaaggaggttcagttacatctgttcacccaggcccatggtgctgattccc
actgatgagcttcacgaaaggctgacaagcaagaatgagaatggattcagttacatcatg
agaggtgctttcttcacctctttgagactggaaagcttcacttcccttcagatgtcaaag
aagggctgtgtctggtctatcatctcacaagtcatctattatctactggtctgttactat
gccttcatacagggttgtcagctgaaacagcagaagtggaggttcttcactgggaaaaga
aacattctggacacaagtataatcctcattagcttcatcctcctggggcttgacatgaag
agtatttctctacataagaaaaacatggcacgataccgcgatgaccaggacagattcatc
agcttctatgaggcagtaaaagtgaactctgctgcgactcaccttgtgggcttcccggtt
ctcctggcaactgttcagttatggaacctgctgcgtcatagccccaggctgcgggtcatc
agcaggacactgagccgagcctgggacgaggtggtgggctttctgctgatcatcctaatc
ctgctgacaggctatgccattgcctttaacctgctgtttggatgcagcatctctgactac
cggacatttttcagctcagcagtgactgttgttggtctcctgatgggaatttctcaccaa
gaggaggttttcgctttagacccagtcctgggcacctttctgatcctcaccagtgtcatc
ttgatggtacttgtggtaattaatcttttcgtttcggccattctcatggcctttggaaaa
gaaagaaagtcgcttaagaaagaagctgcactaatagatacactgctacagaagctctca
aatttgttaggaatcagttggccccaaaaaacctcatctgagcaagcagccacgacagca
gtgggcagtgacactgaagttttagatgaactaccttaa

DBGET integrated database retrieval system