KEGG   Homo sapiens (human): 342510
Entry
342510            CDS       T01001                                 

Gene name
CD300E, CD300LE, CLM-2, CLM2, CMRF35-A5, IREM-2, IREM2, PIgR-2, PIgR2
Definition
(RefSeq) CD300e molecule
  KO
K06719  CD300 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    342510 (CD300E)
CD molecules [BR:hsa04090]
 Proteins
  342510 (CD300E)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2 I-set
Other DBs
NCBI-GeneID: 342510
NCBI-ProteinID: NP_852114
OMIM: 609801
HGNC: 28874
Ensembl: ENSG00000186407
Vega: OTTHUMG00000067605
Pharos: Q496F6(Tdark)
UniProt: Q496F6 B4E0V9
Position
17q25.1
AA seq 205 aa
MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCES
IVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPS
DLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPHFLLVVLL
KLPLLLSMLGAVFWVNRPQWAPPGR
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtggctgctcccagctctactccttctctgcctctcaggctgtttgtctctgaagggc
cccggctctgtgactggcactgcgggggactctctgacagtgtggtgtcagtatgagagc
atgtacaagggatataacaagtactggtgccgaggacagtacgacacgtcatgtgagagc
attgtggagaccaagggagaagagaaggtggagaggaatggccgcgtgtccatcagagac
cacccggaggctctcgccttcactgtgaccatgcagaacctcaatgaagatgatgctgga
tcttactggtgcaaaattcagacagtgtgggtcctggattcatggtcacgcgatccctcg
gacctggttagggtgtatgtttccccagcaattacaaccccaaggaggaccacacatcca
gccacacctcccatcttcctggtggtgaaccctgggcgaaacctcagcaccggggaggtg
ttgacccaaaattcagggttccggctcagcagccctcacttcctgctcgtggtccttctg
aagctgcccctgctcctgagcatgctgggtgctgtcttctgggtgaacaggcctcagtgg
gctcctcctggaagatag

DBGET integrated database retrieval system