KEGG   Homo sapiens (human): 342538
Entry
342538            CDS       T01001                                 
Symbol
NACA2, ANAC, NACAL
Name
(RefSeq) nascent polypeptide associated complex subunit alpha 2
  KO
K03626  nascent polypeptide-associated complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    342538 (NACA2)
SSDB
Motif
Pfam: NAC HYPK_UBA
Other DBs
NCBI-GeneID: 342538
NCBI-ProteinID: NP_954984
OMIM: 609274
HGNC: 23290
Ensembl: ENSG00000253506
UniProt: Q9H009
Position
17:complement(61590421..61591219)
AA seq 215 aa
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID
EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
NT seq 648 nt   +upstreamnt  +downstreamnt
atgccgggcgaagccacagaaaccgtccctgctacagagcaggagttgccgcagtcccag
gctgagacagggtctggaacagcatctgatagtggtgaatcagtaccagggattgaagaa
caggattccacccagaccaccacacaaaaagcctggctggtggcagcagctgaaattgat
gaagaaccagtcggtaaagcaaaacagagtcggagtgaaaagagggcacggaaggctatg
tccaaactgggtcttctacaggttacaggagttactagagtcactatctggaaatctaag
aatatcctctttgtcatcacaaaactggacgtctacaagagccctgcttcggatgcctac
atagtttttggggaagccaagatccaagatttatctcagcaagcacaactagcagctgcg
gagaaattcagagttcaaggtgaagctgtcggaaacattcaagaaaacacacagactcca
actgtacaagaggagagtgaagaggaagaggtcgatgaaacaggtgtagaagttaaagac
gtgaaattggtcatgtcacaagcaaatgtgtcgagagcaaaggcagtccgagctctgaag
aacaacagtaatgatattgtaaatgcgattatggaattaacagtgtaa

DBGET integrated database retrieval system