KEGG   Homo sapiens (human): 342574Help
Entry
342574            CDS       T01001                                 

Gene name
KRT27, K25IRS3, KRT25C
Definition
(RefSeq) keratin 27
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    342574 (KRT27)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    342574 (KRT27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    342574 (KRT27)
   04147 Exosome [BR:hsa04147]
    342574 (KRT27)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     342574 (KRT27)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   342574 (KRT27)
  Exosomal proteins of other body fluids (saliva and urine)
   342574 (KRT27)
  Exosomal proteins of colorectal cancer cells
   342574 (KRT27)
  Exosomal proteins of melanoma cells
   342574 (KRT27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 UPF0242 APG6_N FlxA
Motif
Other DBs
NCBI-GeneID: 342574
NCBI-ProteinID: NP_853515
OMIM: 616676
HGNC: 30841
Ensembl: ENSG00000171446
Vega: OTTHUMG00000133371
Pharos: Q7Z3Y8(Tdark)
UniProt: Q7Z3Y8
Position
17q21.2
AA seq 459 aa AA seqDB search
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcgcttttcttctacctccaggagacttggctcttgcgggggcactggctct
gtgaggctctctagtgggggagcaggctttggggctggaaacacatgcggtgtgccaggc
attggaagtggcttctcttgtgcttttgggggcagctcatctgcaggaggctatggcgga
ggtctgggcgggggaagtgcttcctgtgctgccttcacagggaatgagcacggcctcctc
tctggcaatgagaaggtgaccatgcagaacctcaacgaccgcttggcctcctacctggag
aatgttcgagccctagaggaggccaacgctgacttggagcagaagatcaaggggtggtat
gagaaatttggacctggttcttgccgtggccttgatcatgattacagcagatatttccca
attattgacgaacttaagaaccagataatttctgcaactaccagtaatgcccatgttgtc
ctgcaaaatgataatgcaagactaacagctgatgacttcagactaaagtttgaaaacgag
ctagcgcttcaccagagcgtggaggcggacatcaatggtttgcgaagagtcctggatgag
ctgaccttgtgcagaacggacctggagatccagctggaaactctcagtgaggagctcgct
tacctcaagaagaatcatgaggaggaaatgaaagctcttcagtgcgcggctggaggcaac
gtgaacgtggagatgaacgcggcccccggggtagacctcacggttctgctgaacaatatg
cgagctgagtacgaagccctcgcagagcagaaccgcagggacgcggaggcctggttcaac
gaaaagagcgcctcgctgcagcagcagatctctgacgacgctggcgccaccacctcagcc
cggaatgagcttatcgagatgaaacgcactcttcaaacccttgagattgaacttcagtcc
ctcttagcaacgaaacactccctggagtgctccttgacagagaccgagagtaactactgt
gcacagctggcacagatccaggctcagatcggggccctggaggagcagctgcaccaggtc
agaaccgagaccgagggccagaagctcgagtatgagcagctccttgacatcaaggtccac
ctggaaaaagaaattgagacctactgcctcctgatagatggagaagatggctcctgttct
aaatcaaaaggctatggaggcccaggaaatcaaacaaaagattcatctaaaaccaccatt
gtcaaaacagttgttgaagagatagatcctcgtggcaaagttctctcatccagagttcac
actgtggaagagaaatccaccaaagtcaacaacaagaatgaacagagggtgtcttcctga

DBGET integrated database retrieval system