KEGG   Homo sapiens (human): 3426Help
Entry
3426              CDS       T01001                                 

Gene name
CFI, AHUS3, ARMD13, C3BINA, C3b-INA, FI, IF, KAF
Definition
(RefSeq) complement factor I
  KO
K01333  complement factor I [EC:3.4.21.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
Disease
H00106  Complement regulatory protein defects
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3426 (CFI)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    3426 (CFI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    3426 (CFI)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3426 (CFI)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.45  complement factor I
     3426 (CFI)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3426 (CFI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3426 (CFI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a SRCR Trypsin_2 SRCR_2
Motif
Other DBs
NCBI-GeneID: 3426
NCBI-ProteinID: NP_000195
OMIM: 217030
HGNC: 5394
Ensembl: ENSG00000205403
Vega: OTTHUMG00000161109
Pharos: P05156(Tbio)
UniProt: P05156 A8K3L0
Structure
PDB: 

Position
4q25
AA seq 583 aa AA seqDB search
MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCV
CKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGN
TDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTE
CLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKA
CDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVA
QEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDA
SGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHEN
YNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNER
VFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYV
WGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcttcatgttttcctgttatttctgtgcttccacttaaggttttgcaaggtc
acttatacatctcaagaggatctggtggagaaaaagtgcttagcaaaaaaatatactcac
ctctcctgcgataaagtcttctgccagccatggcagagatgcattgagggcacctgtgtt
tgtaaactaccgtatcagtgcccaaagaatggcactgcagtgtgtgcaactaacaggaga
agcttcccaacatactgtcaacaaaagagtttggaatgtcttcatccagggacaaagttt
ttaaataacggaacatgcacagccgaaggaaagtttagtgtttccttgaagcatggaaat
acagattcagagggaatagttgaagtaaaacttgtggaccaagataagacaatgttcata
tgcaaaagcagctggagcatgagggaagccaacgtggcctgccttgaccttgggtttcaa
caaggtgctgatactcaaagaaggtttaagttgtctgatctctctataaattccactgaa
tgtctacatgtgcattgccgaggattagagaccagtttggctgaatgtacttttactaag
agaagaactatgggttaccaggatttcgctgatgtggtttgttatacacagaaagcagat
tctccaatggatgacttctttcagtgtgtgaatgggaaatacatttctcagatgaaagcc
tgtgatggtatcaatgattgtggagaccaaagtgatgaactgtgttgtaaagcatgccaa
ggcaaaggcttccattgcaaatcgggtgtttgcattccaagccagtatcaatgcaatggt
gaggtggactgcattacaggggaagatgaagttggctgtgcaggctttgcatctgtggct
caagaagaaacagaaattttgactgctgacatggatgcagaaagaagacggataaaatca
ttattacctaaactatcttgtggagttaaaaacagaatgcacattcgaaggaaacgaatt
gtgggaggaaagcgagcacaactgggagacctcccatggcaggtggcaattaaggatgcc
agtggaatcacctgtgggggaatttatattggtggctgttggattctgactgctgcacat
tgtctcagagccagtaaaactcatcgttaccaaatatggacaacagtagtagactggata
caccccgaccttaaacgtatagtaattgaatacgtggatagaattattttccatgaaaac
tacaatgcaggcacttaccaaaatgacatcgctttgattgaaatgaaaaaagacggaaac
aaaaaagattgtgagctgcctcgttccatccctgcctgtgtcccctggtctccttaccta
ttccaacctaatgatacatgcatcgtttctggctggggacgagaaaaagataacgaaaga
gtcttttcacttcagtggggtgaagttaaactaataagcaactgctctaagttttacgga
aatcgtttctatgaaaaagaaatggaatgtgcaggtacatatgatggttccatcgatgcc
tgtaaaggggactctggaggccccttagtctgtatggatgccaacaatgtgacttatgtc
tggggtgttgtgagttggggggaaaactgtggaaaaccagagttcccaggtgtttacacc
aaagtggccaattattttgactggattagctaccatgtaggaaggccttttatttctcag
tacaatgtataa

DBGET integrated database retrieval system