KEGG   Homo sapiens (human): 343171
Entry
343171            CDS       T01001                                 
Symbol
OR2W3, OR2W3P, OR2W8P, OST718
Name
(RefSeq) olfactory receptor family 2 subfamily W member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    343171 (OR2W3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    343171 (OR2W3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    343171 (OR2W3)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 343171
NCBI-ProteinID: NP_001001957
OMIM: 616729
HGNC: 15021
Ensembl: ENSG00000238243
Pharos: Q7Z3T1(Tdark)
UniProt: Q7Z3T1
Position
1:247895587..247896531
AA seq 314 aa
MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMY
FFLAHLSFLDLSFTTSSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAY
DRCVAICKPLHYMVIMNPRLCRGLVSVTWGCGVANSLAMSPVTLRLPRCGHHEVDHFLRE
MPALIRMACVSTVAIEGTVFVLAVGVVLSPLVFILLSYSYIVRAVLQIRSASGRQKAFGT
CGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGA
LGRLLLGKRELGKE
NT seq 945 nt   +upstreamnt  +downstreamnt
atggatggaaccaatggcagcacccaaacccatttcatcctactgggattctctgaccga
ccccatctggagaggatcctctttgtggtcatcctgatcgcgtacctcctgaccctcgta
ggcaacaccaccatcatcctggtgtcccggctggacccccacctccacacccccatgtac
ttcttcctcgcccacctttccttcctggacctcagtttcaccaccagctccatcccccag
ctgctctacaaccttaatggatgtgacaagaccatcagctacatgggctgtgccatccag
ctcttcctgttcctgggtctgggtggtgtggagtgcctgcttctggctgtcatggcctat
gaccggtgtgtggctatctgcaagcccctgcactacatggtgatcatgaaccccaggctc
tgccggggcttggtgtcagtgacctggggctgtggggtggccaactccttggccatgtct
cctgtgaccctgcgcttaccccgctgtgggcaccacgaggtggaccacttcctgcgtgag
atgcccgccctgatccggatggcctgcgtcagcactgtggccatcgaaggcaccgtcttt
gtcctggcggtgggtgttgtgctgtcccccttggtgtttatcctgctctcttacagctac
attgtgagggctgtgttacaaattcggtcagcatcaggaaggcagaaggccttcggcacc
tgcggctcccatctcactgtggtctcccttttctatggaaacatcatctacatgtacatg
cagccaggagccagttcttcccaggaccagggcatgttcctcatgctcttctacaacatt
gtcacccccctcctcaatcctctcatctacaccctcagaaacagagaggtgaagggggca
ctgggaaggttgcttctggggaagagagagctaggaaaggagtaa

DBGET integrated database retrieval system