KEGG   Homo sapiens (human): 3434Help
Entry
3434              CDS       T01001                                 

Gene name
IFIT1, C56, G10P1, IFI-56, IFI-56K, IFI56, IFIT-1, IFNAI1, ISG56, P56, RNM561
Definition
(RefSeq) interferon induced protein with tetratricopeptide repeats 1
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    3434 (IFIT1)
   05168 Herpes simplex infection
    3434 (IFIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_12 TPR_19 TPR_8 TPR_1 TPR_14 TPR_11 TPR_7 TPR_6 TPR_16 TPR_17 TPR_10 ANAPC3 TPR_15 NARP1 TPR_4 DUF4268 Sec16_C ANAPC5 Fis1_TPR_C TPR_21
Motif
Other DBs
NCBI-GeneID: 3434
NCBI-ProteinID: NP_001539
OMIM: 147690
HGNC: 5407
Ensembl: ENSG00000185745
Vega: OTTHUMG00000018712
Pharos: P09914(Tbio)
UniProt: P09914
Structure
PDB: 

Position
10q23.31
AA seq 478 aa AA seqDB search
MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaaatggtgatgatcatcaggtcaaggatagtctggagcaattgagatgtcac
tttacatgggagttatccattgatgacgatgaaatgcctgatttagaaaacagagtcttg
gatcagattgaattcctagacaccaaatacagtgtgggaatacacaacctactagcctat
gtgaaacacctgaaaggccagaatgaggaagccctgaagagcttaaaagaagctgaaaac
ttaatgcaggaagaacatgacaaccaagcaaatgtgaggagtctggtgacctggggcaac
tttgcctggatgtattaccacatgggcagactggcagaagcccagacttacctggacaag
gtggagaacatttgcaagaagctttcaaatcccttccgctatagaatggagtgtccagaa
atagactgtgaggaaggatgggccttgctgaagtgtggaggaaaaaattatgaacgggcc
aaggcctgctttgaaaaggtgcttgaagtggaccctgaaaaccctgaatccagcgctggg
tatgcgatctctgcctatcgcctggatggctttaaattagccacaaaaaatcacaagcca
ttttctttgcttcccctaaggcaggctgtccgcttaaatccagacaatggatatattaag
gttctccttgccctgaagcttcaggatgaaggacaggaagctgaaggagaaaagtacatt
gaagaagctctagccaacatgtcctcacagacctatgtctttcgatatgcagccaagttt
taccgaagaaaaggctctgtggataaagctcttgagttattaaaaaaggccttgcaggaa
acacccacttctgtcttactgcatcaccagatagggctttgctacaaggcacaaatgatc
caaatcaaggaggctacaaaagggcagcctagagggcagaacagagaaaagctagacaaa
atgataagatcagccatatttcattttgaatctgcagtggaaaaaaagcccacatttgag
gtggctcatctagacctggcaagaatgtatatagaagcaggcaatcacagaaaagctgaa
gagaattttcaaaaattgttatgcatgaaaccagtggtagaagaaacaatgcaagacata
catttccactatggtcggtttcaggaatttcaaaagaaatctgacgtcaatgcaattatc
cattatttaaaagctataaaaatagaacaggcatcattaacaagggataaaagtatcaat
tctttgaagaaattggttttaaggaaacttcggagaaaggcattagatctggaaagcttg
agcctccttgggttcgtctacaaattggaaggaaatatgaatgaagccctggagtactat
gagcgggccctgagactggctgctgactttgagaactctgtgagacaaggtccttag

DBGET integrated database retrieval system