KEGG   Homo sapiens (human): 3437Help
Entry
3437              CDS       T01001                                 

Gene name
IFIT3, CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, P60, RIG-G, cig41
Definition
(RefSeq) interferon induced protein with tetratricopeptide repeats 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_8 TPR_19 TPR_1 TPR_17 TPR_12 TPR_11 TPR_14 TPR_7 TPR_16 TPR_6 TPR_15 TPR_MalT NARP1 Cohesin_load ChAPs ANAPC3
Motif
Other DBs
NCBI-GeneID: 3437
NCBI-ProteinID: NP_001026853
OMIM: 604650
HGNC: 5411
Ensembl: ENSG00000119917
Vega: OTTHUMG00000018708
Pharos: O14879(Tbio)
UniProt: O14879 Q5T765
Structure
PDB: 

Position
10q23.31
AA seq 490 aa AA seqDB search
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYI
KHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKV
KQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAM
YHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQ
TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA
SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQS
HQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPR
ELLSNSEQLN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggtcaccaagaattccctggagaaaatccttccacagctgaaatgccatttc
acctggaacttattcaaggaagacagtgtctcaagggatctagaagatagagtgtgtaac
cagattgaatttttaaacactgagttcaaagctacaatgtacaacttgttggcctacata
aaacacctagatggtaacaacgaggcagccctggaatgcttacggcaagctgaagagtta
atccagcaagaacatgctgaccaagcagaaatcagaagtctagtcacttggggaaactac
gcctgggtctactatcacttgggcagactctcagatgctcagatttatgtagataaggtg
aaacaaacctgcaagaaattttcaaatccatacagtattgagtattctgaacttgactgt
gaggaagggtggacacaactgaagtgtggaagaaatgaaagggcgaaggtgtgttttgag
aaggctctggaagaaaagcccaacaacccagaattctcctctggactggcaattgcgatg
taccatctggataatcacccagagaaacagttctctactgatgttttgaagcaggccatt
gagctgagtcctgataaccaatacgtcaaggttctcttgggcctgaaactgcagaagatg
aataaagaagctgaaggagagcagtttgttgaagaagccttggaaaagtctccttgccaa
acagatgtcctccgcagtgcagccaaattttacagaagaaaaggtgacctagacaaagct
attgaactgtttcaacgggtgttggaatccacaccaaacaatggctacctctatcaccag
attgggtgctgctacaaggcaaaagtaagacaaatgcagaatacaggagaatctgaagct
agtggaaataaagagatgattgaagcactaaagcaatatgctatggactattcgaataaa
gctcttgagaagggactgaatcctctgaatgcatactccgatctcgctgagttcctggag
acggaatgttatcagacaccattcaataaggaagtccctgatgctgaaaagcaacaatcc
catcagcgctactgcaaccttcagaaatataatgggaagtctgaagacactgctgtgcaa
catggtttagagggtttgtccataagcaaaaaatcaactgacaaggaagagatcaaagac
caaccacagaatgtatctgaaaatctgcttccacaaaatgcaccaaattattggtatctt
caaggattaattcataagcagaatggagatctgctgcaagcagccaaatgttatgagaag
gaactgggccgcctgctaagggatgccccttcaggcataggcagtattttcctgtcagca
tctgagcttgaggatggtagtgaggaaatgggccagggcgcagtcagctccagtcccaga
gagctcctctctaactcagagcaactgaactga

DBGET integrated database retrieval system