KEGG   Homo sapiens (human): 3439Help
Entry
3439              CDS       T01001                                 

Gene name
IFNA1, IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@
Definition
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06219  JAK-STAT signaling
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3439 (IFNA1)
   04151 PI3K-Akt signaling pathway
    3439 (IFNA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3439 (IFNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3439 (IFNA1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3439 (IFNA1)
   04621 NOD-like receptor signaling pathway
    3439 (IFNA1)
   04622 RIG-I-like receptor signaling pathway
    3439 (IFNA1)
   04623 Cytosolic DNA-sensing pathway
    3439 (IFNA1)
   04650 Natural killer cell mediated cytotoxicity
    3439 (IFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3439 (IFNA1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3439 (IFNA1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3439 (IFNA1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3439 (IFNA1)
   05162 Measles
    3439 (IFNA1)
   05164 Influenza A
    3439 (IFNA1)
   05161 Hepatitis B
    3439 (IFNA1)
   05160 Hepatitis C
    3439 (IFNA1)
   05168 Herpes simplex virus 1 infection
    3439 (IFNA1)
   05163 Human cytomegalovirus infection
    3439 (IFNA1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3439 (IFNA1)
   05169 Epstein-Barr virus infection
    3439 (IFNA1)
   05165 Human papillomavirus infection
    3439 (IFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3439 (IFNA1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3439 (IFNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3439
NCBI-ProteinID: NP_076918
OMIM: 147660
HGNC: 5417
Ensembl: ENSG00000197919
Vega: OTTHUMG00000019673
Pharos: P01562(Tbio)
UniProt: P01562 L0N195
Structure
PDB: 

Position
9p21.3
AA seq 189 aa AA seqDB search
MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFG
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccctttgctttactgatggtcctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatgctc
ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3440Help
Entry
3440              CDS       T01001                                 

Gene name
IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2
Definition
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3440 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3440 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05168 Herpes simplex virus 1 infection
    3440 (IFNA2)
   05163 Human cytomegalovirus infection
    3440 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05169 Epstein-Barr virus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3440 (IFNA2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3440 (IFNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon APC1_C DDHD CBF
Motif
Other DBs
NCBI-GeneID: 3440
NCBI-ProteinID: NP_000596
OMIM: 147562
HGNC: 5423
Ensembl: ENSG00000188379
Vega: OTTHUMG00000019674
Pharos: P01563(Tbio)
UniProt: P01563
Structure
PDB: 

Position
9p21.3
AA seq 188 aa AA seqDB search
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Homo sapiens (human): 3441Help
Entry
3441              CDS       T01001                                 

Gene name
IFNA4, IFN-alpha4a, INFA4
Definition
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3441 (IFNA4)
   04151 PI3K-Akt signaling pathway
    3441 (IFNA4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3441 (IFNA4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3441 (IFNA4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3441 (IFNA4)
   04621 NOD-like receptor signaling pathway
    3441 (IFNA4)
   04622 RIG-I-like receptor signaling pathway
    3441 (IFNA4)
   04623 Cytosolic DNA-sensing pathway
    3441 (IFNA4)
   04650 Natural killer cell mediated cytotoxicity
    3441 (IFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3441 (IFNA4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3441 (IFNA4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3441 (IFNA4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3441 (IFNA4)
   05162 Measles
    3441 (IFNA4)
   05164 Influenza A
    3441 (IFNA4)
   05161 Hepatitis B
    3441 (IFNA4)
   05160 Hepatitis C
    3441 (IFNA4)
   05168 Herpes simplex virus 1 infection
    3441 (IFNA4)
   05163 Human cytomegalovirus infection
    3441 (IFNA4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3441 (IFNA4)
   05169 Epstein-Barr virus infection
    3441 (IFNA4)
   05165 Human papillomavirus infection
    3441 (IFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3441 (IFNA4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3441 (IFNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3441
NCBI-ProteinID: NP_066546
OMIM: 147564
HGNC: 5425
Ensembl: ENSG00000236637
Vega: OTTHUMG00000019660
Pharos: P05014(Tbio)
UniProt: P05014
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG
FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagacatgatttcgga
ttccccgaggaggagtttgatggccaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3442Help
Entry
3442              CDS       T01001                                 

Gene name
IFNA5, IFN-alpha-5, IFN-alphaG, INA5, INFA5, leIF_G
Definition
(RefSeq) interferon alpha 5
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3442 (IFNA5)
   04151 PI3K-Akt signaling pathway
    3442 (IFNA5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3442 (IFNA5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3442 (IFNA5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3442 (IFNA5)
   04621 NOD-like receptor signaling pathway
    3442 (IFNA5)
   04622 RIG-I-like receptor signaling pathway
    3442 (IFNA5)
   04623 Cytosolic DNA-sensing pathway
    3442 (IFNA5)
   04650 Natural killer cell mediated cytotoxicity
    3442 (IFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3442 (IFNA5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3442 (IFNA5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3442 (IFNA5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3442 (IFNA5)
   05162 Measles
    3442 (IFNA5)
   05164 Influenza A
    3442 (IFNA5)
   05161 Hepatitis B
    3442 (IFNA5)
   05160 Hepatitis C
    3442 (IFNA5)
   05168 Herpes simplex virus 1 infection
    3442 (IFNA5)
   05163 Human cytomegalovirus infection
    3442 (IFNA5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3442 (IFNA5)
   05169 Epstein-Barr virus infection
    3442 (IFNA5)
   05165 Human papillomavirus infection
    3442 (IFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3442 (IFNA5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3442 (IFNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon CBF DDHD
Motif
Other DBs
NCBI-GeneID: 3442
NCBI-ProteinID: NP_002160
OMIM: 147565
HGNC: 5426
Ensembl: ENSG00000147873
Vega: OTTHUMG00000019664
Pharos: P01569(Tbio)
UniProt: P01569
Position
9p21.3
AA seq 189 aa AA seqDB search
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE
ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN
LQERLRRKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccttgccctttgttttactgatggccctggtggtgctcaactgcaagtcaatctgt
tctctgggctgtgatctgcctcagacccacagcctgagtaacaggaggactttgatgata
atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
tttcctcaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa
gcctgtatgatgcaggaggttggagtggaagacactcctctgatgaatgtggactctatc
ctgactgtgagaaaatactttcaaagaatcaccctctatctgacagagaagaaatacagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctctttatcagcaaac
ttgcaagaaagattaaggaggaaggaatga

KEGG   Homo sapiens (human): 3443Help
Entry
3443              CDS       T01001                                 

Gene name
IFNA6, IFN-alphaK
Definition
(RefSeq) interferon alpha 6
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3443 (IFNA6)
   04151 PI3K-Akt signaling pathway
    3443 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3443 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3443 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3443 (IFNA6)
   04621 NOD-like receptor signaling pathway
    3443 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    3443 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    3443 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    3443 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3443 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3443 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3443 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3443 (IFNA6)
   05162 Measles
    3443 (IFNA6)
   05164 Influenza A
    3443 (IFNA6)
   05161 Hepatitis B
    3443 (IFNA6)
   05160 Hepatitis C
    3443 (IFNA6)
   05168 Herpes simplex virus 1 infection
    3443 (IFNA6)
   05163 Human cytomegalovirus infection
    3443 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3443 (IFNA6)
   05169 Epstein-Barr virus infection
    3443 (IFNA6)
   05165 Human papillomavirus infection
    3443 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3443 (IFNA6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3443 (IFNA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3443
NCBI-ProteinID: NP_066282
OMIM: 147566
HGNC: 5427
Ensembl: ENSG00000120235
Vega: OTTHUMG00000019676
Pharos: P05013(Tbio)
UniProt: P05013
Position
9p21.3
AA seq 189 aa AA seqDB search
MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLE
ACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRRKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctggactgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc
ctggcacaaatgaggagaatctctcttttctcctgtctgaaggacagacatgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctgaagccatctctgtcctc
catgaggtgattcagcagaccttcaacctcttcagcacaaaggactcatctgttgcttgg
gatgagaggcttctagacaaactctatactgaactttaccagcagctgaatgacctggaa
gcctgtgtgatgcaggaggtgtgggtgggagggactcccctgatgaatgaggactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaaaaagtacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaaggttaaggaggaaggaataa

KEGG   Homo sapiens (human): 3444Help
Entry
3444              CDS       T01001                                 

Gene name
IFNA7, IFN-alphaJ, IFNA-J
Definition
(RefSeq) interferon alpha 7
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3444 (IFNA7)
   04151 PI3K-Akt signaling pathway
    3444 (IFNA7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3444 (IFNA7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3444 (IFNA7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3444 (IFNA7)
   04621 NOD-like receptor signaling pathway
    3444 (IFNA7)
   04622 RIG-I-like receptor signaling pathway
    3444 (IFNA7)
   04623 Cytosolic DNA-sensing pathway
    3444 (IFNA7)
   04650 Natural killer cell mediated cytotoxicity
    3444 (IFNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3444 (IFNA7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3444 (IFNA7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3444 (IFNA7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3444 (IFNA7)
   05162 Measles
    3444 (IFNA7)
   05164 Influenza A
    3444 (IFNA7)
   05161 Hepatitis B
    3444 (IFNA7)
   05160 Hepatitis C
    3444 (IFNA7)
   05168 Herpes simplex virus 1 infection
    3444 (IFNA7)
   05163 Human cytomegalovirus infection
    3444 (IFNA7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3444 (IFNA7)
   05169 Epstein-Barr virus infection
    3444 (IFNA7)
   05165 Human papillomavirus infection
    3444 (IFNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3444 (IFNA7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3444 (IFNA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3444
NCBI-ProteinID: NP_066401
OMIM: 147567
HGNC: 5428
Ensembl: ENSG00000214042
Vega: OTTHUMG00000019662
Pharos: P01567(Tdark)
UniProt: P01567
Position
9p21.3
AA seq 189 aa AA seqDB search
MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFR
FPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTN
LKKGLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcccggtccttttctttactgatggtcgtgctggtactcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgcgtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcttgaaggacagacatgaattcaga
ttcccagaggaggagtttgatggccaccagttccagaagactcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggacttcatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgaaaaaaggattaaggaggaaggattga

KEGG   Homo sapiens (human): 3445Help
Entry
3445              CDS       T01001                                 

Gene name
IFNA8, IFN-alphaB
Definition
(RefSeq) interferon alpha 8
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3445 (IFNA8)
   04151 PI3K-Akt signaling pathway
    3445 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3445 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3445 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3445 (IFNA8)
   04621 NOD-like receptor signaling pathway
    3445 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    3445 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    3445 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    3445 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3445 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3445 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3445 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3445 (IFNA8)
   05162 Measles
    3445 (IFNA8)
   05164 Influenza A
    3445 (IFNA8)
   05161 Hepatitis B
    3445 (IFNA8)
   05160 Hepatitis C
    3445 (IFNA8)
   05168 Herpes simplex virus 1 infection
    3445 (IFNA8)
   05163 Human cytomegalovirus infection
    3445 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3445 (IFNA8)
   05169 Epstein-Barr virus infection
    3445 (IFNA8)
   05165 Human papillomavirus infection
    3445 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3445 (IFNA8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3445 (IFNA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon DDHD
Motif
Other DBs
NCBI-GeneID: 3445
NCBI-ProteinID: NP_002161
OMIM: 147568
HGNC: 5429
Ensembl: ENSG00000120242
Vega: OTTHUMG00000019677
Pharos: P32881(Tbio)
UniProt: P32881
Position
9p21.3
AA seq 189 aa AA seqDB search
MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFE
FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE
SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc
tctctgggctgtgatctgcctcagactcacagcctgggtaacaggagggccttgatactc
ctggcacaaatgcgaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaggactcatctgctgctttg
gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaatgacctggag
tcctgtgtgatgcaggaagtgggggtgatagagtctcccctgatgtacgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctatatctgacagagaagaaatacagc
tcttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaatga

KEGG   Homo sapiens (human): 3446Help
Entry
3446              CDS       T01001                                 

Gene name
IFNA10, IFN-alphaC
Definition
(RefSeq) interferon alpha 10
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3446 (IFNA10)
   04151 PI3K-Akt signaling pathway
    3446 (IFNA10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3446 (IFNA10)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3446 (IFNA10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3446 (IFNA10)
   04621 NOD-like receptor signaling pathway
    3446 (IFNA10)
   04622 RIG-I-like receptor signaling pathway
    3446 (IFNA10)
   04623 Cytosolic DNA-sensing pathway
    3446 (IFNA10)
   04650 Natural killer cell mediated cytotoxicity
    3446 (IFNA10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3446 (IFNA10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3446 (IFNA10)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3446 (IFNA10)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3446 (IFNA10)
   05162 Measles
    3446 (IFNA10)
   05164 Influenza A
    3446 (IFNA10)
   05161 Hepatitis B
    3446 (IFNA10)
   05160 Hepatitis C
    3446 (IFNA10)
   05168 Herpes simplex virus 1 infection
    3446 (IFNA10)
   05163 Human cytomegalovirus infection
    3446 (IFNA10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3446 (IFNA10)
   05169 Epstein-Barr virus infection
    3446 (IFNA10)
   05165 Human papillomavirus infection
    3446 (IFNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3446 (IFNA10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3446 (IFNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3446
NCBI-ProteinID: NP_002162
OMIM: 147577
HGNC: 5418
Ensembl: ENSG00000186803
Vega: OTTHUMG00000019658
Pharos: P01566(Tbio)
UniProt: P01566
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR
IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttacttatggccgtgctggtgctcagctacaaatccatctgt
tctctaggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctgggacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttccga
atcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaatagagaggaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3447Help
Entry
3447              CDS       T01001                                 

Gene name
IFNA13
Definition
(RefSeq) interferon alpha 13
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3447 (IFNA13)
   04151 PI3K-Akt signaling pathway
    3447 (IFNA13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3447 (IFNA13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3447 (IFNA13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3447 (IFNA13)
   04621 NOD-like receptor signaling pathway
    3447 (IFNA13)
   04622 RIG-I-like receptor signaling pathway
    3447 (IFNA13)
   04623 Cytosolic DNA-sensing pathway
    3447 (IFNA13)
   04650 Natural killer cell mediated cytotoxicity
    3447 (IFNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3447 (IFNA13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3447 (IFNA13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3447 (IFNA13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3447 (IFNA13)
   05162 Measles
    3447 (IFNA13)
   05164 Influenza A
    3447 (IFNA13)
   05161 Hepatitis B
    3447 (IFNA13)
   05160 Hepatitis C
    3447 (IFNA13)
   05168 Herpes simplex virus 1 infection
    3447 (IFNA13)
   05163 Human cytomegalovirus infection
    3447 (IFNA13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3447 (IFNA13)
   05169 Epstein-Barr virus infection
    3447 (IFNA13)
   05165 Human papillomavirus infection
    3447 (IFNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3447 (IFNA13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3447 (IFNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3447
NCBI-ProteinID: NP_008831
OMIM: 147578
HGNC: 5419
Ensembl: ENSG00000233816
Vega: OTTHUMG00000019675
Pharos: P01562(Tbio)
UniProt: P01562 A0A087WWS6
Structure
PDB: 

Position
9p21.3
AA seq 190 aa AA seqDB search
MMASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDF
GFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDL
EACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLST
NLQERLRRKE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctcgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagc
tgctctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatg
ctcctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgacttt
ggatttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtc
ctccatgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgct
tgggatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttg
gaagcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactcc
atcttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaaca
aacttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3448Help
Entry
3448              CDS       T01001                                 

Gene name
IFNA14, IFN-alphaH, LEIF2H
Definition
(RefSeq) interferon alpha 14
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3448 (IFNA14)
   04151 PI3K-Akt signaling pathway
    3448 (IFNA14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3448 (IFNA14)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3448 (IFNA14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3448 (IFNA14)
   04621 NOD-like receptor signaling pathway
    3448 (IFNA14)
   04622 RIG-I-like receptor signaling pathway
    3448 (IFNA14)
   04623 Cytosolic DNA-sensing pathway
    3448 (IFNA14)
   04650 Natural killer cell mediated cytotoxicity
    3448 (IFNA14)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3448 (IFNA14)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3448 (IFNA14)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3448 (IFNA14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3448 (IFNA14)
   05162 Measles
    3448 (IFNA14)
   05164 Influenza A
    3448 (IFNA14)
   05161 Hepatitis B
    3448 (IFNA14)
   05160 Hepatitis C
    3448 (IFNA14)
   05168 Herpes simplex virus 1 infection
    3448 (IFNA14)
   05163 Human cytomegalovirus infection
    3448 (IFNA14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3448 (IFNA14)
   05169 Epstein-Barr virus infection
    3448 (IFNA14)
   05165 Human papillomavirus infection
    3448 (IFNA14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3448 (IFNA14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3448 (IFNA14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon APC1_C
Motif
Other DBs
NCBI-GeneID: 3448
NCBI-ProteinID: NP_002163
OMIM: 147579
HGNC: 5420
Ensembl: ENSG00000228083
Vega: OTTHUMG00000019665
Pharos: P01570(Tdark)
UniProt: P01570
Position
9p21.3
AA seq 189 aa AA seqDB search
MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFE
FPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcattgccctttgctttaatgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtaatctgtctcaaacccacagcctgaataacaggaggactttgatgctc
atggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggaatttgatggcaaccagttccagaaagctcaagccatctctgtcctc
catgagatgatgcagcagaccttcaatctcttcagcacaaagaactcatctgctgcttgg
gatgagaccctcctagaaaaattctacattgaacttttccagcaaatgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctttatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3449Help
Entry
3449              CDS       T01001                                 

Gene name
IFNA16, IFN-alpha-16, IFN-alphaO
Definition
(RefSeq) interferon alpha 16
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3449 (IFNA16)
   04151 PI3K-Akt signaling pathway
    3449 (IFNA16)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3449 (IFNA16)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3449 (IFNA16)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3449 (IFNA16)
   04621 NOD-like receptor signaling pathway
    3449 (IFNA16)
   04622 RIG-I-like receptor signaling pathway
    3449 (IFNA16)
   04623 Cytosolic DNA-sensing pathway
    3449 (IFNA16)
   04650 Natural killer cell mediated cytotoxicity
    3449 (IFNA16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3449 (IFNA16)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3449 (IFNA16)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3449 (IFNA16)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3449 (IFNA16)
   05162 Measles
    3449 (IFNA16)
   05164 Influenza A
    3449 (IFNA16)
   05161 Hepatitis B
    3449 (IFNA16)
   05160 Hepatitis C
    3449 (IFNA16)
   05168 Herpes simplex virus 1 infection
    3449 (IFNA16)
   05163 Human cytomegalovirus infection
    3449 (IFNA16)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3449 (IFNA16)
   05169 Epstein-Barr virus infection
    3449 (IFNA16)
   05165 Human papillomavirus infection
    3449 (IFNA16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3449 (IFNA16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3449 (IFNA16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3449
NCBI-ProteinID: NP_002164
OMIM: 147580
HGNC: 5421
Ensembl: ENSG00000147885
Vega: OTTHUMG00000019663
Pharos: P05015(Tdark)
UniProt: P05015
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFG
FPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLE
ACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTN
LQKGLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagactcacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagatatgatttcgga
ttcccccaggaggtgtttgatggcaaccagttccagaaggctcaagccatctctgccttc
catgagatgatccagcagaccttcaatctcttcagcacaaaggattcatctgctgcttgg
gatgagaccctcctagacaaattctacattgaacttttccagcaactgaatgacctagaa
gcctgtgtgacacaggaggttggggtggaagagattgccctgatgaatgaggactccatc
ctggctgtgaggaaatactttcaaagaatcactctttatctgatggggaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgcaaaaaggattaagaaggaaggattga

KEGG   Homo sapiens (human): 3451Help
Entry
3451              CDS       T01001                                 

Gene name
IFNA17, IFN-alphaI, IFNA, INFA, LEIF2C1
Definition
(RefSeq) interferon alpha 17
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3451 (IFNA17)
   04151 PI3K-Akt signaling pathway
    3451 (IFNA17)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3451 (IFNA17)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3451 (IFNA17)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3451 (IFNA17)
   04621 NOD-like receptor signaling pathway
    3451 (IFNA17)
   04622 RIG-I-like receptor signaling pathway
    3451 (IFNA17)
   04623 Cytosolic DNA-sensing pathway
    3451 (IFNA17)
   04650 Natural killer cell mediated cytotoxicity
    3451 (IFNA17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3451 (IFNA17)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3451 (IFNA17)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3451 (IFNA17)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3451 (IFNA17)
   05162 Measles
    3451 (IFNA17)
   05164 Influenza A
    3451 (IFNA17)
   05161 Hepatitis B
    3451 (IFNA17)
   05160 Hepatitis C
    3451 (IFNA17)
   05168 Herpes simplex virus 1 infection
    3451 (IFNA17)
   05163 Human cytomegalovirus infection
    3451 (IFNA17)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3451 (IFNA17)
   05169 Epstein-Barr virus infection
    3451 (IFNA17)
   05165 Human papillomavirus infection
    3451 (IFNA17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3451 (IFNA17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3451 (IFNA17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3451
NCBI-ProteinID: NP_067091
OMIM: 147583
HGNC: 5422
Ensembl: ENSG00000234829
Vega: OTTHUMG00000019667
Pharos: P01571(Tbio)
UniProt: P01571
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
LPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLE
ACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKILRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctaggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
cttccccaggaggagtttgatggcaaccagttccagaagactcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaataacctggaa
gcatgtgtgatacaggaggttgggatggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatctctctctttttcaacaaac
ttgcaaaaaatattaaggaggaaggattga

KEGG   Homo sapiens (human): 3452Help
Entry
3452              CDS       T01001                                 

Gene name
IFNA21, IFN-alphaI, LeIF_F, leIF-F
Definition
(RefSeq) interferon alpha 21
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06134  CGAS-STING signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3452 (IFNA21)
   04151 PI3K-Akt signaling pathway
    3452 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3452 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3452 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3452 (IFNA21)
   04621 NOD-like receptor signaling pathway
    3452 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    3452 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    3452 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    3452 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3452 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3452 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3452 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3452 (IFNA21)
   05162 Measles
    3452 (IFNA21)
   05164 Influenza A
    3452 (IFNA21)
   05161 Hepatitis B
    3452 (IFNA21)
   05160 Hepatitis C
    3452 (IFNA21)
   05168 Herpes simplex virus 1 infection
    3452 (IFNA21)
   05163 Human cytomegalovirus infection
    3452 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3452 (IFNA21)
   05169 Epstein-Barr virus infection
    3452 (IFNA21)
   05165 Human papillomavirus infection
    3452 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3452 (IFNA21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3452 (IFNA21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3452
NCBI-ProteinID: NP_002166
OMIM: 147584
HGNC: 5424
Ensembl: ENSG00000137080
Vega: OTTHUMG00000019653
Pharos: P01568(Tbio)
UniProt: P01568
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLE
ACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKI
FQERLRRKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gaacagagcctcctagaaaaattttccactgaacttaaccagcagctgaatgacctggaa
gcctgcgtgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc
ctggctgtgaagaaatacttccaaagaatcactctttatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaaaatt
tttcaagaaagattaaggaggaaggaatga

DBGET integrated database retrieval system