KEGG   Homo sapiens (human): 344Help
Entry
344               CDS       T01001                                 

Gene name
APOC2, APO-CII, APOC-II
Definition
(RefSeq) apolipoprotein C2
  KO
K22287  apolipoprotein C-II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Disease
H00154  Hyperlipoproteinemia, type I
H01635  Hyperlipidemia
H01784  Primary hyperchylomicronemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04979 Cholesterol metabolism
    344 (APOC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apo-CII DUF3708
Motif
Other DBs
NCBI-GeneID: 344
NCBI-ProteinID: NP_000474
OMIM: 608083
HGNC: 609
Ensembl: ENSG00000234906
Vega: OTTHUMG00000180847
Pharos: P02655(Tbio)
UniProt: P02655 A0A024R0T9
Structure
PDB: 

Position
19q13.32
AA seq 101 aa AA seqDB search
MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgggcacacgactcctcccagctctgtttcttgtcctcctggtattgggatttgaggtc
caggggacccaacagccccagcaagatgagatgcctagcccgaccttcctcacccaggtg
aaggaatctctctccagttactgggagtcagcaaagacagccgcccagaacctgtacgag
aagacatacctgcccgctgtagatgagaaactcagggacttgtacagcaaaagcacagca
gccatgagcacttacacaggcatttttactgaccaagttctttctgtgctgaagggagag
gagtaa

DBGET integrated database retrieval system