KEGG   Homo sapiens (human): 3440Help
Entry
3440              CDS       T01001                                 

Gene name
IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2
Definition
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3440 (IFNA2)
  Immune diseases
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  Infectious diseases
   05152 Tuberculosis
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05168 Herpes simplex infection
    3440 (IFNA2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3440 (IFNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon CBF DDHD
Motif
Other DBs
NCBI-GeneID: 3440
NCBI-ProteinID: NP_000596
OMIM: 147562
HGNC: 5423
Ensembl: ENSG00000188379
Vega: OTTHUMG00000019674
Pharos: P01563(Tbio)
UniProt: P01563
Structure
PDB: 

Position
9p21.3
AA seq 188 aa AA seqDB search
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

DBGET integrated database retrieval system