KEGG   Homo sapiens (human): 344558Help
Entry
344558            CDS       T01001                                 

Gene name
SH3RF3, POSH2, SH3MD4
Definition
(RefSeq) SH3 domain containing ring finger 3
  KO
K12171  E3 ubiquitin-protein ligase SH3RF [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    344558 (SH3RF3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    344558 (SH3RF3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     344558 (SH3RF3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     344558 (SH3RF3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    344558 (SH3RF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 zf-RING_11 Prok-RING_4 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 344558
NCBI-ProteinID: NP_001092759
HGNC: 24699
Ensembl: ENSG00000172985
Vega: OTTHUMG00000153439
Pharos: Q8TEJ3(Tdark)
UniProt: Q8TEJ3
Position
2q13
AA seq 882 aa AA seqDB search
MLLGASWLCASKAAAAAAQSEGDEDRPGERRRRRAAATAAGAGEDMDESSLLDLLECSVC
LERLDTTAKVLPCQHTFCRRCLESIVCSRHELRCPECRILVGCGVDELPANILLVRLLDG
IRQRPRAGTSPGGSPPARPIPGQSAAPTLAGGGGGAAGSTPGSPVFLSAAAGSTAGSLRE
LATSRTAPAAKNPCLLPYGKALYSYEGKEPGDLKFNKGDIIVLRRKVDEQWYHGELHGTQ
GFLPASYIQCIQPLPHAPPQGKALYDFEMKDKDQDKDCLTFTKDEILTVLRRVDENWAEG
MLGDKIGIFPLLYVELNDSAKQLIEMDKPCPAAASSCNASLPSDSGAVASVAPSPTLSSS
GAVSAFQRRVDGKKNTKKRHSFTALSVTHRSSQAASHRHSMEISAPVLISSSDPRAAARI
GDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKS
DELELHKGEMYRVLEKCQDGWFKGASLRTGVSGVFPGNYVTPVSRVPAGGAGPPRNNVVG
GSPLAKGITTTMHPGSGSLSSLATATRPALPITTPQAHAQHPTASPPTGSCLRHSAQPTA
SQARSTISTAAHSAAQAQDRPTATVSPLRTQNSPSRLPATSLRPHSVVSPQHSHQPPVQM
CPRPAIPLTSAASAITPPNVSAANLNGEAGGGPIGVLSTSSPTNTGCKLDEKKSEKKEKK
SGLLKLLAGASTKKKSRSPPSVSPTHDPQVAVDALLQGAVGPEVSSLSIHGRAGSCPIES
EMQGAMGMEPLHRKAGSLDLNFTSPSRQAPLSMAAIRPEPKLLPRERYRVVVSYPPQSEA
EIELKEGDIVFVHKKREDGWYKGTLQRNGRTGLFPGSFVESF
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcggagcgtcctggctgtgcgcatccaaggcggccgccgctgctgcgcagagc
gagggcgacgaggacaggccaggcgagcgacggcggcgtcgggcggcggccaccgccgcg
ggggcgggcgaggacatggacgagtcgtcgctgctggacctgctggagtgctccgtgtgt
ctggagcgcctggacaccacggccaaggtgctgccatgccaacacactttctgccgccgc
tgcctggagagcatcgtgtgctcgcgccacgagctgcgctgccccgagtgccgcatcctg
gtgggctgcggcgtggacgaactgcccgccaacatcttgctggtgcgactgctggacggc
atccgtcagcggccccgcgcgggcaccagccccggcggcagcccgcccgcgcgtcccatc
ccaggccagagtgcggcccccacgctcgcgggcggcgggggcggcgcggcaggcagcacc
ccgggttccccggttttcctctccgcggccgcgggcagcaccgccggcagtctgcgggag
ctggcgaccagcaggaccgcgccggcggcaaagaatccctgcctgcttccctatggcaag
gccctctacagctacgaggggaaggaacctggtgacctcaagttcaacaagggggacatc
atcgtcctgcggcgcaaggtggatgaacagtggtaccacggcgagctgcacggcacacag
ggcttcctcccagccagctatatccagtgcatccagcccttgccacacgccccgccccag
ggaaaagcactttatgatttcgagatgaaggacaaagaccaagacaaggactgtctgacc
ttcaccaaggacgagattctgacggtgctcaggagagtggatgagaactgggcggaaggc
atgctgggagacaagatcgggatcttcccgctcctgtacgtggagctcaatgactccgcc
aagcagctcattgagatggacaagccatgcccagccgctgcatccagctgcaatgcctcc
ctgccctctgactccggcgctgtggccagcgtggccccaagtcccactttaagcagctca
ggggcggtcagtgcctttcagcggcgtgtggatggcaagaagaacaccaagaaacgccac
tccttcaccgcgctcagtgtgacgcacagatcctcccaggctgccagccacaggcattcc
atggaaattagtgctccagtgttgatcagctccagcgatccccgagccgcggccaggatt
ggagaccttgctcatctgtcgtgcgctgctcccacccaggatgtctcctcctcggcggga
tctacccccacggctgtcccacgggctgcctcggtgtctggagagcagggcacgcctccc
aaggtccagctgcccctcaacgtgtacctggcgctctacgcctacaagccccagaagagt
gacgagctggagctgcacaagggagagatgtaccgggtcctcgagaagtgtcaggatggc
tggttcaagggggcgtctctgaggaccggggtctctggggtgttccccggaaactacgtg
acacccgtttccagggtgcctgcaggaggggcagggccgccccggaataatgtagtcgga
gggtctccactggccaaagggataaccacaaccatgcacccaggcagtgggagtctgagc
agcctggccactgccaccaggcccgccctgcccatcaccactccccaggcccacgcccag
caccccacagcctcgcccccaacaggcagctgtctacggcactcagcccagccaacggcc
agccaagcccggagcaccatttcaacagctgcccactctgcagcccaggctcaggaccgg
ccaactgccaccgtgtcacccctgcgcacccagaactctccatcccgcctgcctgccacc
agcctcaggccccactcggtggtgtccccgcagcacagccaccagcccccggtgcagatg
tgcccacggccggccatccccctcacatcagcagcatcagccatcacacctcccaacgtc
agtgccgcaaacctcaacggggaggctggaggggggcccatcggtgttctgtccacatcc
agccccaccaacacgggatgcaaactagacgagaagaaaagtgaaaagaaagagaagaag
agtgggctcctgaagcttctagccggagcatccaccaagaagaagtcacgctccccgcca
tctgtgtctccaacccacgacccccaggtggccgtggacgccctgctccaaggtgcagtg
ggccccgaagtgtcctcactgtccatccacggcagggcagggtcctgccccatagagagc
gagatgcagggtgccatggggatggagcctctgcacaggaaggcaggctccttggatcta
aacttcacatctccttcccggcaagctccgctgtccatggctgccatccgccccgagccc
aagctgttgcccagagagaggtaccgcgtggtggtctcgtacccaccccagagtgaggcg
gagatcgagctgaaggaaggcgacatcgtctttgtgcacaagaagcgtgaggacggctgg
tacaaggggaccctgcagcggaacggccgcacaggcctcttcccgggcagcttcgtcgag
agcttctga

DBGET integrated database retrieval system