KEGG   Homo sapiens (human): 344752
Entry
344752            CDS       T01001                                 
Symbol
AADACL2
Name
(RefSeq) arylacetamide deacetylase like 2
  KO
K14350  arylacetamide deacetylase-like 2 [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    344752 (AADACL2)
SSDB
Motif
Pfam: Abhydrolase_3 BD-FAE COesterase Say1_Mug180 Esterase Peptidase_S9 AXE1 Mbeg1-like
Other DBs
NCBI-GeneID: 344752
NCBI-ProteinID: NP_997248
HGNC: 24427
Ensembl: ENSG00000197953
UniProt: Q6P093
Position
3:151733927..151761339
AA seq 401 aa
MGLKALCLGLLCVLFVSHFYTPMPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEE
FISMIFRLDYTQPLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSS
KQRAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKILTKYGVDP
TRICIAGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGLQITDSYLPSHRENEHGIV
LTRDVAIKLVSLYFTKDEALPWAMRRNQHMPLESRHLFKFVNWSILLPEKYRKDYVYTEP
ILGGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQ
VVHEHIEDGIHGALSFMTSPFYLRLGLRIRDMYVSWLDKNL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggggctaaaagctctctgtttggggctgctttgtgttctttttgtctctcatttttac
acacccatgccagacaacattgaagaaagctggaaaataatggccttggatgccatcgct
aaaacttgtacatttacggctatgtgttttgaaaatatgcgtattatgagatatgaagag
tttatatccatgatattcaggctggattatacccaaccactttcagatgaatacatcaca
gtgactgatacaacatttgttgacattccagtacgattgtacttgccaaaaagaaagtca
gaaacccgaaggcgagctgtgatatattttcatggtggtggtttttgttttggaagttcc
aaacagagggcttttgacttcctgaatagatggacggcaaacacgcttgatgctgttgtt
gtaggcgtggactataggctggctcctcaacaccactttcctgctcagtttgaagatggc
cttgctgcagtcaaattttttcttttggaaaaaattcttacaaaatatggagtggatccc
acccgaatctgcattgcgggagacagttctgggggcaatttagcaacagcggtcactcaa
caggtgcagaatgatgctgaaataaaacataaaatcaagatgcaagtcttactttaccct
ggcttacagataacagattcttatttgccatctcaccgagaaaatgagcatggtatagtt
ttgaccagggatgtagccataaaactcgtgagcttatatttcaccaaggatgaagcactt
ccctgggcaatgagaagaaaccaacacatgcctctggagtcaagacatctgtttaagttt
gttaactggagtattcttcttcctgagaagtatagaaaagactatgtatatactgaacca
attcttggaggacttagttattcattgccaggacttacagacagcagagcattacccttg
ttggccaatgattctcagttacagaatttgccactaacctatattcttacttgtcaacat
gatctcttaagagatgatggacttatgtatgttacaagacttcgaaatgttggagtccaa
gttgttcatgaacatattgaggatggaattcatggagctttatcattcatgacttcacca
ttttatttacgtctaggtcttaggataagagatatgtatgtaagttggctggataagaat
ttataa

DBGET integrated database retrieval system