KEGG   Homo sapiens (human): 344758
Entry
344758            CDS       T01001                                 

Gene name
GPR149, IEDA, PGR10, R35
Definition
(RefSeq) G protein-coupled receptor 149
  KO
K08433  G protein-coupled receptor 149
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    344758 (GPR149)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    344758 (GPR149)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 344758
NCBI-ProteinID: NP_001033794
HGNC: 23627
Ensembl: ENSG00000174948
Vega: OTTHUMG00000159131
Pharos: Q86SP6(Tdark)
UniProt: Q86SP6 Q2MKA6
Position
3q25.2
AA seq 731 aa
MSLFLSNLSTNDSSLWKENHNSTDLLNPPGTLNIYLFCLTCLMTFAALVGSIYSLISLLK
MQNRTVVSMLVASWSVDDLMSVLSVTIFMFLQWPNEVPGYFQFLCTTSALMYLCQGLSSN
LKATLLVSYNFYTMHRGVGSQTASRRSGQVLGVVLTVWAASLLLSALPLCGWGAFVRTPW
GCLVDCSSSYVLFLSIVYALAFGLLVGLSVPLTHRLLCSEEPPRLHSNYQEISRGASIPG
TPPTAGRVVSLSPEDAPGPSLRRSGGCSPSSDTVFGPGAPAAAGAEACRRENRGTLYGTR
SFTVSVAQKRFALILALTKVVLWLPMMMHMVVQNVVGFQSLPLETFSFLLTLLATTVTPV
FVLSKRWTHLPCGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKSYGIYKIAHEDYYDD
DENSIFYHNLMNSECETTKDPQRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNTDITE
AKQDSNNKKDAFSDKTGGDINYEETTFSEGPERRLSHEESQKPDLSDWEWCRSKSERTPR
QRSGYALAIPLCAFQGTVSLHAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGHE
PNSEDSSSTFVDTSVKIHLEVLEICDNEEALDTVSIISNISQSSTQVRSPSLRYSRKENR
FVSCDLGETASYSLFLPTSNPDGDINISIPDTVEAHRQNSKRQHQERDGYQEEIQLLNKA
YRKREEESKGS
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtctttatttctcagtaacttatcaacaaatgactctagcctgtggaaagagaatcat
aattctacggaccttttaaatccgccaggaaccctgaatatctatcttttttgcttgaca
tgtctcatgacttttgcagccttggtgggcagcatttattcactaatttccctgctgaaa
atgcagaacagaactgttgtgtccatgcttgtggcttcctggtctgtggatgatctcatg
agcgtcctgtcggtgaccatcttcatgtttttgcagtggccaaacgaggtccccggttac
ttccaatttctgtgcaccacctctgccttaatgtatttatgccagggcctctctagcaac
ttgaaggcgactctcctagtctcttacaacttttatacgatgcacagaggtgtggggagc
cagacagcctccagaagatcgggccaggtgctcggcgtggtgctgaccgtgtgggcagcc
agtctgctgctctcggcgctcccgctgtgcggctggggcgccttcgtgcgcacgccctgg
ggctgcctggtggactgctccagctcctacgtactattcctctctatcgtgtacgctttg
gccttcggactcctcgtgggcctctcagtcccactcactcaccgattgctgtgttcggag
gagccgccgagactccactccaactaccaggaaatttcccgtggagcttcaattcctggg
acccctcctactgcggggagagtggtttccctgtccccagaggatgctccaggcccgagt
ctgcggcgctctgggggatgctctccgagctccgacaccgtgttcggaccgggtgcgccc
gctgccgctggggctgaagcctgcaggcgtgagaaccgggggactctctatggcaccagg
agcttcaccgtgagcgtagcgcagaagcgcttcgctttgatcctagcgcttacaaaagtc
gtcctttggctgcccatgatgatgcacatggtggtccagaacgtcgtggggtttcagagc
cttcccttggagacattcagctttctacttaccctgctggccaccactgtaaccccagtg
tttgtcttgtccaaacgctggacccacttgccctgtggctgcatcatcaactgcaggcag
aacgcatatgcagtggcgtccgatgggaaaaaaatcaagagaaaaggctttgaattcaat
ctatcattccaaaaaagttatgggatttataaaatagcacatgaagattactatgatgat
gatgaaaattccatattctatcacaacctgatgaactctgagtgtgaaactacaaaagac
cctcagagagacaaccgtaacatcttcaatgctataaaagtagaaatcagcaccacgccc
tctctggacagctccacacaaagaggcatcaacaaatgcacaaatactgatattacagaa
gctaaacaggattccaacaacaaaaaggatgcgttttctgacaaaacaggaggtgatatt
aactatgaagaaactaccttttctgaagggccagaaagaagactgtctcatgaagagagt
cagaaaccagatctttcagactgggagtggtgtaggagtaaatcagaaagaacccctcgt
cagcgttccggttatgcccttgccattcccttgtgtgcattccaggggactgtgtctctc
catgcacctacagggaaaaccctatctctttctacctatgaggtaagcgcagaagggcaa
aaaataactccagcctctaagaaaatagaagtctatcgatccaaaagtgttggccatgaa
ccaaactcagaagattcttcatccacgtttgtggacaccagtgtgaaaatacacttggag
gttcttgaaatttgtgataatgaagaggccttggacactgtgtcaatcattagtaacatc
agtcagtcctccacacaagtcagatctccatccctacgttactccaggaaagaaaacaga
tttgtttcatgtgacctaggggaaacagcctcatactccctctttttgcccaccagtaat
cctgatggtgatattaatatctccattccagacacagtagaagcacacaggcagaacagt
aaaaggcagcatcaagagagggatggctaccaggaggaaatccagttgttaaataaagct
tacagaaaaagagaggaagaaagcaagggtagttag

DBGET integrated database retrieval system