KEGG   Homo sapiens (human): 3451Help
Entry
3451              CDS       T01001                                 

Gene name
IFNA17, IFN-alphaI, IFNA, INFA, LEIF2C1
Definition
(RefSeq) interferon alpha 17
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3451 (IFNA17)
   04151 PI3K-Akt signaling pathway
    3451 (IFNA17)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3451 (IFNA17)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3451 (IFNA17)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3451 (IFNA17)
   04621 NOD-like receptor signaling pathway
    3451 (IFNA17)
   04622 RIG-I-like receptor signaling pathway
    3451 (IFNA17)
   04623 Cytosolic DNA-sensing pathway
    3451 (IFNA17)
   04650 Natural killer cell mediated cytotoxicity
    3451 (IFNA17)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3451 (IFNA17)
  09163 Immune diseases
   05320 Autoimmune thyroid disease
    3451 (IFNA17)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    3451 (IFNA17)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    3451 (IFNA17)
   05162 Measles
    3451 (IFNA17)
   05164 Influenza A
    3451 (IFNA17)
   05161 Hepatitis B
    3451 (IFNA17)
   05160 Hepatitis C
    3451 (IFNA17)
   05168 Herpes simplex infection
    3451 (IFNA17)
   05163 Human cytomegalovirus infection
    3451 (IFNA17)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3451 (IFNA17)
   05165 Human papillomavirus infection
    3451 (IFNA17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3451 (IFNA17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3451 (IFNA17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3451
NCBI-ProteinID: NP_067091
OMIM: 147583
HGNC: 5422
Ensembl: ENSG00000234829
Vega: OTTHUMG00000019667
Pharos: P01571(Tbio)
UniProt: P01571
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
LPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLE
ACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKILRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctaggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
cttccccaggaggagtttgatggcaaccagttccagaagactcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaataacctggaa
gcatgtgtgatacaggaggttgggatggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatctctctctttttcaacaaac
ttgcaaaaaatattaaggaggaaggattga

DBGET integrated database retrieval system