KEGG   Homo sapiens (human): 345275Help
Entry
345275            CDS       T01001                                 

Gene name
HSD17B13, HMFN0376, NIIL497, SCDR9, SDR16C3
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 13
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 345275
NCBI-ProteinID: NP_835236
OMIM: 612127
HGNC: 18685
Ensembl: ENSG00000170509
Vega: OTTHUMG00000130602
Pharos: Q7Z5P4(Tdark)
UniProt: Q7Z5P4
Position
4q22.1
AA seq 300 aa AA seqDB search
MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQ
SILVLWDINKRGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNN
AGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIP
YLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTSCLCPVFVNTGFTKNPSTRLWPVLETD
EVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAILNRMQNIQFEAVVGHKIKMK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcctagaaatccttctgcttctgatcaccatcatctactcctacttggag
tcgttggtgaagtttttcattcctcagaggagaaaatctgtggctggggagattgttctc
attactggagctgggcatggaataggcaggcagactacttatgaatttgcaaaacgacag
agcatattggttctgtgggatattaataagcgcggtgtggaggaaactgcagctgagtgc
cgaaaactaggcgtcactgcgcatgcgtatgtggtagactgcagcaacagagaagagatc
tatcgctctctaaatcaggtgaagaaagaagtgggtgatgtaacaatcgtggtgaataat
gctgggacagtatatccagccgatcttctcagcaccaaggatgaagagattaccaagaca
tttgaggtcaacatcctaggacatttttggatcacaaaagcacttcttccatcgatgatg
gagagaaatcatggccacatcgtcacagtggcttcagtgtgcggccacgaagggattcct
tacctcatcccatattgttccagcaaatttgccgctgttggctttcacagaggtctgaca
tcagaacttcaggccttgggaaaaactggtatcaaaacctcatgtctctgcccagttttt
gtgaatactgggttcaccaaaaatccaagcacaagattatggcctgtattggagacagat
gaagtcgtaagaagtctgatagatggaatacttaccaataagaaaatgatttttgttcca
tcgtatatcaatatctttctgagactacagaagtttcttcctgaacgcgcctcagcgatt
ttaaatcgtatgcagaatattcaatttgaagcagtggttggccacaaaatcaaaatgaaa
tga

DBGET integrated database retrieval system