KEGG   Homo sapiens (human): 3454Help
Entry
3454              CDS       T01001                                 

Gene name
IFNAR1, AVP, IFN-alpha-REC, IFNAR, IFNBR, IFRC
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
Drug target
Albinterferon alfa-2b: D08844
Anifrolumab: D11082
Interferon alfa natural: D03305
Interferon alfa-2a: D00745
Interferon alfa-2b: D02745
Interferon alfa-n1: D04552
Interferon alfacon-1: D02744
Interferon alpha (DG01750): D04553
Interferon beta natural: D03304
Interferon beta-1a: D04554
Interferon beta-1b: D00746
Peginterferon alfa-2a: D02747
Peginterferon alfa-2b: D02748
Peginterferon beta-1a: D10483
Ropeginterferon alfa-2b: D11027
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3454 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    3454 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3454 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3454 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3454 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    3454 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    3454 (IFNAR1)
  09158 Development
   04380 Osteoclast differentiation
    3454 (IFNAR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3454 (IFNAR1)
  09172 Infectious diseases: Viral
   05162 Measles
    3454 (IFNAR1)
   05164 Influenza A
    3454 (IFNAR1)
   05161 Hepatitis B
    3454 (IFNAR1)
   05160 Hepatitis C
    3454 (IFNAR1)
   05168 Herpes simplex infection
    3454 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3454 (IFNAR1)
   05169 Epstein-Barr virus infection
    3454 (IFNAR1)
   05165 Human papillomavirus infection
    3454 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3454 (IFNAR1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IFN receptor family
   3454 (IFNAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac fn3
Motif
Other DBs
NCBI-GeneID: 3454
NCBI-ProteinID: NP_000620
OMIM: 107450
HGNC: 5432
Ensembl: ENSG00000142166
Vega: OTTHUMG00000065126
Pharos: P17181(Tclin)
UniProt: P17181
Structure
PDB: 

Position
21q22.11
AA seq 557 aa AA seqDB search
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI
ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ
NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN
EDESESKTSEELQQDFV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcgtcctcctgggcgcgacgaccctagtgctcgtcgccgtggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggtcgacatc
atagatgacaactttatcctgaggtggaacaggagcgatgagtctgtcgggaatgtgact
ttttcattcgattatcaaaaaactgggatggataattggataaaattgtctgggtgtcag
aatattactagtaccaaatgcaacttttcttcactcaagctgaatgtttatgaagaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgactcattt
acaccatttcgcaaagctcagattggtcctccagaagtacatttagaagctgaagataag
gcaatagtgatacacatctctcctggaacaaaagatagtgttatgtgggctttggatggt
ttaagctttacatatagcttagttatctggaaaaactcttcaggtgtagaagaaaggatt
gaaaatatttattccagacataaaatttataaactctcaccagagactacttattgtcta
aaagttaaagcagcactacttacgtcatggaaaattggtgtctatagtccagtacattgt
ataaagaccacagttgaaaatgaactacctccaccagaaaatatagaagtcagtgtccaa
aatcagaactatgttcttaaatgggattatacatatgcaaacatgacctttcaagttcag
tggctccacgcctttttaaaaaggaatcctggaaaccatttgtataaatggaaacaaata
cctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaacgttttccaaaaa
ggaatttaccttctccgcgtacaagcatctgatggaaataacacatctttttggtctgaa
gagataaagtttgatactgaaatacaagctttcctacttcctccagtctttaacattaga
tcccttagtgattcattccatatctatatcggtgctccaaaacagtctggaaacacgcct
gtgatccaggattatccactgatttatgaaattattttttgggaaaacacttcaaatgct
gagagaaaaattatcgagaaaaaaactgatgttacagttcctaatttgaaaccactgact
gtatattgtgtgaaagccagagcacacaccatggatgaaaagctgaataaaagcagtgtt
tttagtgacgctgtatgtgagaaaacaaaaccaggaaatacctctaaaatttggcttata
gttggaatttgtattgcattatttgctctcccgtttgtcatttatgctgcgaaagtcttc
ttgagatgcatcaattatgtcttctttccatcacttaaaccttcttccagtatagatgag
tatttctctgaacagccattgaagaatcttctgctttcaacttctgaggaacaaatcgaa
aaatgtttcataattgaaaatataagcacaattgctacagtagaagaaactaatcaaact
gatgaagatcataaaaaatacagttcccaaactagccaagattcaggaaattattctaat
gaagatgaaagcgaaagtaaaacaagtgaagaactacagcaggactttgtatga

DBGET integrated database retrieval system