KEGG   Homo sapiens (human): 3454Help
Entry
3454              CDS       T01001                                 

Gene name
IFNAR1, AVP, IFN-alpha-REC, IFNAR, IFNBR, IFRC
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
Drug target
Albinterferon alfa-2b: D08844
Interferon alfa natural: D03305
Interferon alfa-2a: D00745
Interferon alfa-2b: D02745
Interferon alfa-n1: D04552
Interferon alfacon-1: D02744
Interferon alpha (DG01750): D04553
Interferon beta natural: D03304
Interferon beta-1a: D04554
Interferon beta-1b: D00746
Peginterferon alfa-2a: D02747
Peginterferon alfa-2b: D02748
Peginterferon beta-1a: D10483
Ropeginterferon alfa-2b: D11027
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3454 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    3454 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3454 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3454 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3454 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    3454 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    3454 (IFNAR1)
  09158 Development
   04380 Osteoclast differentiation
    3454 (IFNAR1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3454 (IFNAR1)
  09167 Infectious diseases
   05162 Measles
    3454 (IFNAR1)
   05164 Influenza A
    3454 (IFNAR1)
   05161 Hepatitis B
    3454 (IFNAR1)
   05160 Hepatitis C
    3454 (IFNAR1)
   05168 Herpes simplex infection
    3454 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3454 (IFNAR1)
   05165 Human papillomavirus infection
    3454 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3454 (IFNAR1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IFN receptor family
   3454 (IFNAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac fn3
Motif
Other DBs
NCBI-GeneID: 3454
NCBI-ProteinID: NP_000620
OMIM: 107450
HGNC: 5432
Ensembl: ENSG00000142166
Vega: OTTHUMG00000065126
Pharos: P17181(Tclin)
UniProt: P17181
Structure
PDB: 

Position
21q22.11
AA seq 557 aa AA seqDB search
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI
ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ
NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN
EDESESKTSEELQQDFV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcgtcctcctgggcgcgacgaccctagtgctcgtcgccgtggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggtcgacatc
atagatgacaactttatcctgaggtggaacaggagcgatgagtctgtcgggaatgtgact
ttttcattcgattatcaaaaaactgggatggataattggataaaattgtctgggtgtcag
aatattactagtaccaaatgcaacttttcttcactcaagctgaatgtttatgaagaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgactcattt
acaccatttcgcaaagctcagattggtcctccagaagtacatttagaagctgaagataag
gcaatagtgatacacatctctcctggaacaaaagatagtgttatgtgggctttggatggt
ttaagctttacatatagcttagttatctggaaaaactcttcaggtgtagaagaaaggatt
gaaaatatttattccagacataaaatttataaactctcaccagagactacttattgtcta
aaagttaaagcagcactacttacgtcatggaaaattggtgtctatagtccagtacattgt
ataaagaccacagttgaaaatgaactacctccaccagaaaatatagaagtcagtgtccaa
aatcagaactatgttcttaaatgggattatacatatgcaaacatgacctttcaagttcag
tggctccacgcctttttaaaaaggaatcctggaaaccatttgtataaatggaaacaaata
cctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaacgttttccaaaaa
ggaatttaccttctccgcgtacaagcatctgatggaaataacacatctttttggtctgaa
gagataaagtttgatactgaaatacaagctttcctacttcctccagtctttaacattaga
tcccttagtgattcattccatatctatatcggtgctccaaaacagtctggaaacacgcct
gtgatccaggattatccactgatttatgaaattattttttgggaaaacacttcaaatgct
gagagaaaaattatcgagaaaaaaactgatgttacagttcctaatttgaaaccactgact
gtatattgtgtgaaagccagagcacacaccatggatgaaaagctgaataaaagcagtgtt
tttagtgacgctgtatgtgagaaaacaaaaccaggaaatacctctaaaatttggcttata
gttggaatttgtattgcattatttgctctcccgtttgtcatttatgctgcgaaagtcttc
ttgagatgcatcaattatgtcttctttccatcacttaaaccttcttccagtatagatgag
tatttctctgaacagccattgaagaatcttctgctttcaacttctgaggaacaaatcgaa
aaatgtttcataattgaaaatataagcacaattgctacagtagaagaaactaatcaaact
gatgaagatcataaaaaatacagttcccaaactagccaagattcaggaaattattctaat
gaagatgaaagcgaaagtaaaacaagtgaagaactacagcaggactttgtatga

DBGET integrated database retrieval system