KEGG   Homo sapiens (human): 3456Help
Entry
3456              CDS       T01001                                 

Gene name
IFNB1, IFB, IFF, IFN-beta, IFNB
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
N00149  TLR3-IRF3 signaling pathway
N00150  Type I IFN signaling pathway
N00161  KSHV vIRF1/2 to TLR3-IRF3 signaling pathway
N00346  HPV E6 to TLR-IRF3 signaling pathway
N00374  TNF-IRF1 signaling pathway
N00375  HPV E7 to TNF-IRF1 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3456 (IFNB1)
   04668 TNF signaling pathway
    3456 (IFNB1)
   04151 PI3K-Akt signaling pathway
    3456 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3456 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3456 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3456 (IFNB1)
   04621 NOD-like receptor signaling pathway
    3456 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    3456 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    3456 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    3456 (IFNB1)
  09158 Development
   04380 Osteoclast differentiation
    3456 (IFNB1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    3456 (IFNB1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    3456 (IFNB1)
   05162 Measles
    3456 (IFNB1)
   05164 Influenza A
    3456 (IFNB1)
   05161 Hepatitis B
    3456 (IFNB1)
   05160 Hepatitis C
    3456 (IFNB1)
   05168 Herpes simplex infection
    3456 (IFNB1)
   05163 Human cytomegalovirus infection
    3456 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3456 (IFNB1)
   05169 Epstein-Barr virus infection
    3456 (IFNB1)
   05165 Human papillomavirus infection
    3456 (IFNB1)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    3456 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3456 (IFNB1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3456 (IFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon Forkhead Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 3456
NCBI-ProteinID: NP_002167
OMIM: 147640
HGNC: 5434
Ensembl: ENSG00000171855
Vega: OTTHUMG00000019652
Pharos: P01574(Tbio)
UniProt: P01574
Structure
PDB: 

Position
9p21.3
AA seq 187 aa AA seqDB search
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcaattttcagtgtcagaag
ctcctgtggcaattgaatgggaggcttgaatactgcctcaaggacaggatgaactttgac
atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc
tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg
aatgagactattgttgagaacctcctggctaatgtctatcatcagataaaccatctgaag
acagtcctggaagaaaaactggagaaagaagatttcaccaggggaaaactcatgagcagt
ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga
cttacaggttacctccgaaactga

DBGET integrated database retrieval system