KEGG   Homo sapiens (human): 345757
Entry
345757            CDS       T01001                                 
Symbol
FAM174A, HGS_RE408, NS5ATP6, TMEM157, UNQ1912
Name
(RefSeq) family with sequence similarity 174 member A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF1180
Other DBs
NCBI-GeneID: 345757
NCBI-ProteinID: NP_940909
HGNC: 24943
Ensembl: ENSG00000174132
Pharos: Q8TBP5(Tdark)
UniProt: Q8TBP5
Position
5:100535374..100586741
AA seq 190 aa
MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGP
TPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPM
TQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDN
TLFDANHPRR
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaaggcctcgcagtgctgctgctgtctcagccacctcttggcttccgtcctcctcctg
ctgttgctgcctgaactaagcgggcccctggcagtcctgctgcaggcagccgaggccgcg
ccaggtcttgggcctcctgaccctagaccacggacattaccgccgctgccaccgggccct
acccctgcccagcagccgggccgtggtctggctgaagctgcggggccgcggggctccgag
ggaggcaatggcagcaaccctgtggccgggcttgagacggacgatcacggagggaaggcc
ggggaaggctcggtgggtggcggccttgctgtgagccccaaccctggcgacaagcccatg
acccagcgggccctgaccgtgttgatggtggtgagcggcgcggtgctggtgtacttcgtg
gtcaggacggtcaggatgagaagaagaaaccgaaagactaggagatatggagttttggac
actaacatagaaaatatggaattgacacctttagaacaggatgatgaggatgatgacaac
acgttgtttgatgccaatcatcctcgaagataa

DBGET integrated database retrieval system