KEGG   Homo sapiens (human): 346389Help
Entry
346389            CDS       T01001                                 

Gene name
MACC1, 7A5, SH3BP4L
Definition
(RefSeq) MET transcriptional regulator MACC1
  KO
K23702   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ZU5 SH3_2 TcpQ
Motif
Other DBs
NCBI-GeneID: 346389
NCBI-ProteinID: NP_877439
OMIM: 612646
HGNC: 30215
Ensembl: ENSG00000183742
Vega: OTTHUMG00000128415
Pharos: Q6ZN28(Tbio)
UniProt: Q6ZN28
Position
7p21.1
AA seq 852 aa AA seqDB search
MLITERKHFRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNA
SKVANPFWNQLSASNPFLDDITQLRNNRKRNNISILKEDPFLFCREIENGNSFDSSGDEL
DVHQLLRQTSSRNSGRSKSVSELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKM
AWLSQRQLARSCLDLNTISQSPGWAQTQLAEVTIACKVNHQGGSVQLPESDITVHVPQGH
VAVGEFQEVSLRAFLDPPHMLNHDLSCTVSPLLEIMLGNLNTMEALLLEMKIGAEVRKDP
FSQVMTEMVCLHSLGKEGPFKVLSNCYIYKDTIQVKLIDLSQVMYLVVAAQAKALPSPAA
TIWDYIHKTTSIGIYGPKYIHPSFTVVLTVCGHNYMPGQLTISDIKKGGKNISPVVFQLW
GKQSFLLDKPQDLSISIFSCDPDFEVKTEGERKEIKQKQLEAGEVVHQQFLFSLVEHREM
HLFDFCVQVEPPNGEPVAQFSITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKY
PTFQDKTLNFSNYGVTLKAVLRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVG
VLRGKIGLVHCKNVKVISKEQVMFMSDSVFTTRNLLEQIVLPLKKLTYIYSVVLTLVSEK
VYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKLKEDCHTERNTRKFLYELIVA
LLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEIPHRGNTGDVA
VEMMWKPAYDFLYTWSAHYGNNYRDVLQDLQSALDRMKNPVTKHWRELTGVLILVNSLEV
LRVTAFSTSEEV
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcactgaaagaaaacattttcggtcaggaagaattgcacaaagtatgtctgaa
gcaaatttgattgacatggaagctggaaaactctcaaaaagttgcaatattacagaatgc
caggacccagacttgcttcacaattggccggatgctttcacccttcgtggtaataatgct
tccaaagttgcaaatccattctggaatcaactgtctgcttctaacccatttttggatgac
ataactcaactaagaaataacaggaagagaaataatatttccatcttaaaggaagatcct
tttcttttctgtagagaaatagaaaatggaaattcttttgattcctccggtgatgaactt
gatgtgcatcagttacttaggcagacttcctcaagaaattctggaagatctaaaagtgtt
tcagaacttctggacattttagacgacacagcacatgcccatcagagtatacataactct
gaccagatcctactacacgacttagagtggcttaaaaatgatcgggaggcttataaaatg
gcttggttaagtcaacgccagctggcccgctcctgccttgatttgaatacaattagtcag
agccctggatgggcccagacacaacttgcggaggtcaccatagcttgcaaagtaaaccat
caaggagggtcagtacaattacctgaatcagacatcactgttcatgtgccccaaggtcat
gtggctgtgggagaattccaagaggtgtctctaagggctttccttgatccgccacacatg
cttaaccatgatctttcgtgcactgtgagcccgttgttggaaatcatgttaggcaacctc
aatacaatggaagcccttttgctggagatgaaaattggggctgaagtaagaaaggatcct
ttcagccaagtcatgacagaaatggtgtgtttacacagcttgggtaaagaaggccctttt
aaagttttaagcaactgctacatttataaagacaccatccaagtcaagctaatcgacttg
agtcaggtaatgtatctagtggttgctgcacaagctaaagctcttccgtcaccagctgcc
accatttgggattatatccacaaaaccacctcaattggaatttatggacccaaatatatc
catcccagttttactgttgttttaacagtttgtggacacaattatatgccaggacagctt
acaatttctgatattaagaagggtggaaaaaacatatctccagttgtgtttcagctctgg
gggaagcagtcatttttacttgacaagccacaagatttaagtatttctattttttcctgt
gatcctgattttgaagtaaagacagaaggagaaaggaaagaaattaaacaaaagcagttg
gaagcaggtgaagtagttcatcaacaatttttattttctttagttgagcacagagagatg
cacttgtttgatttttgtgttcaagtggagcctcccaatggtgaaccagttgcacagttc
tctatcactactcctgatccaaccccaaacctaaaaagactctcgaatctgccaggctat
ttgcagaagaaggaggaaatcaagtctgctcctttatcaccaaaaattcttgttaaatat
cctacatttcaagataaaacattgaactttagcaactatggggtaaccctgaaggcagtg
ctaagacaaagcaagattgattacttccttgaatatttcaaaggggacacaatagctctc
ctcggggaaggtaaggtaaaagctattggtcagtccaaagtgaaagaatggtatgtagga
gtcctcagaggtaagattggacttgtacactgcaaaaatgtcaaggtgatttcaaaggag
caagtaatgtttatgtcagatagtgtctttacaaccagaaatcttcttgaacagattgtc
ctgcctttaaaaaaattgacttatatctactcagttgtattaaccttggtgtcagaaaaa
gtttatgattggaaagttttagctgatgtcctgggttactcacatctgtccctggaagat
tttgatcaaattcaagcagacaaagaatcagagaaagtttcttatgttataaagaagtta
aaggaagattgccacacagagagaaatacaaggaagtttctgtatgaacttattgtggct
cttctgaaaatggattgccaagagttagtcgcacgtctcatccaagaagctgctgttctg
acttcagctgtcaagcttggaaaaggctggagggaactagctgaaaagttagtacgactc
acaaagcaacaaatggaggcatatgaaattcctcatcgaggaaacactggagatgttgct
gttgagatgatgtggaaacctgcctatgattttctgtatacctggagtgctcactatgga
aataactacagagatgtgttacaagaccttcagtcagctttggacagaatgaaaaaccct
gtgactaaacactggagagaattaactggagttttaatactagtaaattctttggaggtt
ttgagagtaactgcattctccacttctgaggaagtatag

DBGET integrated database retrieval system