KEGG   Homo sapiens (human): 347
Entry
347               CDS       T01001                                 
Symbol
APOD
Name
(RefSeq) apolipoprotein D
  KO
K03098  apolipoprotein D and lipocalin family protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    347 (APOD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   347 (APOD)
SSDB
Motif
Pfam: Lipocalin_2 Lipocalin VDE Triabin LRV
Other DBs
NCBI-GeneID: 347
NCBI-ProteinID: NP_001638
OMIM: 107740
HGNC: 612
Ensembl: ENSG00000189058
Pharos: P05090(Tbio)
UniProt: P05090
Structure
Position
3:complement(195568705..195583940)
AA seq 189 aa
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR
CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI
LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT
DQVNCPKLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtgatgctgctgctgctgctttccgcactggctggcctcttcggtgcggcagaggga
caagcatttcatcttgggaagtgccccaatcctccggtgcaggagaattttgacgtgaat
aagtatctcggaagatggtacgaaattgagaagatcccaacaacctttgagaatggacgc
tgcatccaggccaactactcactaatggaaaacggaaagatcaaagtgttaaaccaggag
ttgagagctgatggaactgtgaatcaaatcgaaggtgaagccaccccagttaacctcaca
gagcctgccaagctggaagttaagttttcctggtttatgccatcggcaccgtactggatc
ctggccaccgactatgagaactatgccctcgtgtattcctgtacctgcatcatccaactt
tttcacgtggattttgcttggatcttggcaagaaaccctaatctccctccagaaacagtg
gactctctaaaaaatatcctgacttctaataacattgatgtcaagaaaatgacggtcaca
gaccaggtgaactgccccaagctctcgtaa

DBGET integrated database retrieval system