KEGG   Homo sapiens (human): 347148
Entry
347148            CDS       T01001                                 

Gene name
QRFP, 26RFa, P518
Definition
(RefSeq) pyroglutamylated RFamide peptide
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RFamide_26RFa
Other DBs
NCBI-GeneID: 347148
NCBI-ProteinID: NP_937823
OMIM: 609795
HGNC: 29982
Ensembl: ENSG00000188710
Vega: OTTHUMG00000131663
Pharos: P83859(Tbio)
UniProt: P83859
Position
9q34.12
AA seq 136 aa
MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR
ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN
GYSRKKGGFSFRFGRR
NT seq 411 nt   +upstreamnt  +downstreamnt
atggtaaggccttaccccctgatctacttcctcttcctgccgctgggcgcctgcttccct
ctactggacagaagagagcccacagacgccatgggtggcctcggagctggagaacgctgg
gccgacctggccatggggccccgaccccactccgtgtggggttcctctcggtggctgaga
gcttcacagccacaggccctgcttgtcatagccagggggctgcagacatcgggcagagag
catgctggctgcagattccgcttcgggaggcaggacgaaggcagtgaggccaccggcttc
ctccctgctgcgggggagaagaccagcggcccgttagggaacctggctgaggagctcaat
ggctacagcaggaagaaaggcggcttcagcttccgcttcggtcggcggtga

DBGET integrated database retrieval system