KEGG   Homo sapiens (human): 347411
Entry
347411            CDS       T01001                                 

Gene name
MPC1L, SLC54A3
Definition
(RefSeq) mitochondrial pyruvate carrier 1 like
  KO
K22138  mitochondrial pyruvate carrier 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    347411 (MPC1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    347411 (MPC1L)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    347411 (MPC1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    347411 (MPC1L)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC54: Mitochondrial pyruvate carrier
   347411 (MPC1L)
SSDB
Motif
Pfam: MPC
Other DBs
NCBI-GeneID: 347411
NCBI-ProteinID: NP_001182451
HGNC: 44205
Ensembl: ENSG00000238205
Vega: OTTHUMG00000024105
Pharos: P0DKB6(Tdark)
UniProt: P0DKB6
Position
Xp11.4
AA seq 136 aa
MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTA
LILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPAT
AAAATSPGSQPPKQAS
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcgaggatggcggtactgtggcggaagatgagagataacttccagagcaaggagttc
cgggaatacgtgagcagcactcacttctggggtcccgcgttcagctggggccttccgctg
gctgcctttaaagacatgaaggcgtcgccggagatcatcagtggccgcatgacaacagcg
ctcatcttgtactcggcgatcttcatgcgcttcgcctaccgcgtacagcctcgaaacctg
ctgctgatggcgtgccactgtaccaacgtgatggcgcagagtgtgcaggccagtcgctac
ctactctactactacggcggcggcggcgccgaggctaaagcccgcgaccctccggctacc
gccgccgctgccaccagcccgggttcccagcccccgaaacaagcttcttaa

DBGET integrated database retrieval system