KEGG   Homo sapiens (human): 347468
Entry
347468            CDS       T01001                                 
Symbol
OR13H1, ORX1
Name
(RefSeq) olfactory receptor family 13 subfamily H member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    347468 (OR13H1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    347468 (OR13H1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    347468 (OR13H1)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 347468
NCBI-ProteinID: NP_001004486
HGNC: 14755
Ensembl: ENSG00000171054
Pharos: Q8NG92(Tdark)
UniProt: Q8NG92 A0A126GW70
Position
X:131544074..131545000
AA seq 308 aa
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY
FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAY
DRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEI
LSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTC
GSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAI
RKVMLKRT
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccatggacaatgtcacagcagtgtttcagtttctccttattggcatttctaactat
cctcaatggagagacacgtttttcacattagtgctgataatttacctcagcacattgttg
gggaatggatttatgatctttcttattcactttgaccccaacctccacactccaatctac
ttcttccttagtaacctgtctttcttagacctttgttatggaacagcttccatgccccag
gctttggtgcattgtttctctacccatccctacctctcttatccccgatgtttggctcaa
acgagtgtctccttggctttggccacagcagagtgcctcctactggctgccatggcctat
gaccgtgtggttgctatcagcaatcccctgcgttattcagtggttatgaatggcccagta
tgtgtctgcttggttgctacctcatgggggacatcacttgtgctcactgccatgctcatc
ctatccctgaggcttcacttctgtggggctaatgtcatcaaccattttgcctgtgagatt
ctctccctcattaagctgacctgttctgataccagcctcaatgaatttatgatcctcatc
accagtatcttcaccctgctgctaccatttgggtttgttctcctctcctacatacgaatt
gctatggctatcataaggattcgctcactccagggcaggctcaaggcctttaccacatgt
ggctctcacctgaccgtggtgacaatcttctatgggtcagccatctccatgtatatgaaa
actcagtccaagtcctaccctgaccaggacaagtttatctcagtgttttatggagctttg
acacccatgttgaaccccctgatatatagcctgagaaaaaaagatgttaaacgggcaata
aggaaagttatgttgaaaaggacatga

DBGET integrated database retrieval system