KEGG   Homo sapiens (human): 347475
Entry
347475            CDS       T01001                                 
Symbol
CCDC160
Name
(RefSeq) coiled-coil domain containing 160
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Crescentin
Other DBs
NCBI-GeneID: 347475
NCBI-ProteinID: NP_001094827
HGNC: 37286
Ensembl: ENSG00000203952
Pharos: A6NGH7(Tdark)
UniProt: A6NGH7
Position
X:134237182..134246842
AA seq 325 aa
MDARRKHWKENMFTPFFSAQDVLEETSEPESSSEQTTADSSKGMEEIYNLSSRKFQEESK
FKRKKYIFQLNEIEQEQNLRENKRNISKNETDTNSASYESSNVDVTTEESFNSTEDNSTC
STDNLPALLRQDIRKKFMERMSPKLCLNLLNEELEELNMKYRKIEEEFENAEKELLHYKK
EIFTKPLNFQETETDASKSDYELQALRNDLSEKATNVKNLSEQLQQAKEVIHKLNLENRN
LKEAVRKLKHQTEVGNVLLKEEMKSYYELEMAKIRGELSVIKNELRTEKTLQARNNRALE
LLRKYYASSMVTSSSILDHFTGDFF
NT seq 978 nt   +upstreamnt  +downstreamnt
atggatgctagaagaaaacactggaaggagaatatgtttactcctttttttagtgcacaa
gatgttctagaagagacttctgagcctgaatcttcttctgaacaaacgactgcagatagc
agcaagggaatggaagaaatttataatttgtccagtagaaagtttcaggaagaaagtaaa
tttaagaggaaaaaatatattttccaactaaatgaaatagaacaagaacaaaatttaaga
gagaacaagagaaacatttcaaagaatgaaacagacacaaattctgcatcctatgaatca
tctaatgtggatgttacaacagaagaaagctttaacagcacagaagataactctacctgc
agtacagataacttaccagctctactaagacaagacataagaaagaaatttatggaaaga
atgtctccaaaactttgcctgaatcttttgaatgaagaactggaagaacttaatatgaaa
tacagaaaaatagaagaggaatttgaaaatgctgaaaaagaacttttgcactacaaaaaa
gaaatattcacaaaacccctaaattttcaagaaacagagacggatgcttcaaaaagtgac
tatgaacttcaagctttaagaaatgacctgtctgaaaaagcaacaaatgtaaaaaactta
agtgaacagctccagcaagccaaagaagtcatccacaaattgaacctagagaacagaaat
ttaaaagaagctgttaggaagttaaagcatcaaaccgaggttggaaatgtgctcctaaaa
gaagaaatgaaatcatattatgaattagaaatggcaaagatccgcggagagctcagtgtc
atcaagaatgaactgagaactgagaagaccctacaagcaagaaataacagagccttggag
ttgcttagaaaatactatgcttcttcaatggtaacatcatcaagtatccttgaccacttt
actggggattttttttaa

DBGET integrated database retrieval system