KEGG   Homo sapiens (human): 347516
Entry
347516            CDS       T01001                                 

Gene name
DGAT2L6, DC3
Definition
(RefSeq) diacylglycerol O-acyltransferase 2 like 6
  KO
K11172  diacylglycerol O-acyltransferase 2-like protein 6 [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    347516 (DGAT2L6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     347516 (DGAT2L6)
SSDB
Motif
Pfam: DAGAT Peptidase_S78_2 Acyltransferase
Other DBs
NCBI-GeneID: 347516
NCBI-ProteinID: NP_940914
OMIM: 300926
HGNC: 23250
Ensembl: ENSG00000184210
Vega: OTTHUMG00000021774
Pharos: Q6ZPD8(Tdark)
UniProt: Q6ZPD8
Position
Xq13.1
AA seq 337 aa
MAFFSRLNLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDW
NTHSQGGRRSAWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINF
ATEATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKGSGNAV
VIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGT
WLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPN
QKTVDKYHALYISALRKLFDQHKVEYGLPETQELTIT
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggctttcttctcccgactgaatctccaggagggcctccaaaccttctttgttttgcaa
tggatcccagtctatatatttttaggagctattcccattctccttataccctactttctg
ttattcagtaagttctggcccttggctgtgctctccttagcctggctcacctatgattgg
aacacccacagtcaaggtggcaggcgttcagcttgggtacgaaactggaccctatggaag
tatttccgaaattacttcccagtaaagctggtgaagactcatgatctttctcccaaacac
aactacatcattgccaatcacccccatggcattctctcttttggtgtcttcatcaacttt
gccactgaggccactggcattgctcggattttcccatccatcactccctttgtagggacc
ttagaaaggatattttggatcccaattgtgcgagaatatgtgatgtcaatgggtgtgtgc
cctgtgagtagctcagccttgaagtacttgctgacccagaaaggctcaggcaatgccgtg
gttattgtggtgggtggagctgctgaagctctcttgtgccgaccaggagcctccactctc
ttcctcaagcagcgtaaaggttttgtgaagatggcactgcaaacaggggcataccttgtc
ccttcatattcctttggtgagaacgaagttttcaatcaggagaccttccctgagggcacg
tggttaaggttgttccaaaaaaccttccaggacacattcaaaaaaatcctgggactaaat
ttctgtaccttccatggccggggcttcactcgcggatcctggggcttcctgcctttcaat
cggcccattaccactgttgttggggaaccccttccaattcccaggattaagaggccaaac
cagaagacagtagacaagtatcacgcactctacatcagtgccctgcgcaagctctttgac
caacacaaagttgaatatggcctccctgagacccaagagctgacaattacataa

DBGET integrated database retrieval system