KEGG   Homo sapiens (human): 347517
Entry
347517            CDS       T01001                                 
Symbol
RAB41
Name
(RefSeq) RAB41, member RAS oncogene family
  KO
K07896  Ras-related protein Rab-41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    347517 (RAB41)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    347517 (RAB41)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA RsgA_GTPase
Other DBs
NCBI-GeneID: 347517
NCBI-ProteinID: NP_001027898
HGNC: 18293
Ensembl: ENSG00000147127
Pharos: Q5JT25(Tdark)
UniProt: Q5JT25
Position
X:70282172..70285002
AA seq 221 aa
MSAFGHDEAWMEAGGFGLEAAERTEYQSLCKSKLLFLGEQSGKTSIISRFMYNSFGCACQ
ATVGIDFLSKTMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFKE
TDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNV
KKLFRRVASALLSTRTSPPPKEGTVEIELESFEESGNRSYC
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtctgcctttggtcacgacgaggcctggatggaggccggaggctttggtctggaggct
gccgaaagaacggaataccagtctctgtgcaaatctaaactcttattcctgggagagcag
agcgggaagacatccatcatcagccgcttcatgtacaacagcttcggctgcgcctgccag
gcaactgttggaattgacttcttgtctaagaccatgtacttggaggaccaaatagttcag
ctgcagctatgggacacagctggccaggagcgctttcacagcctaattcctagctacatt
cgtgattcaactattgcagtggttgtctatgacattacaaacatcaattcttttaaggag
acagataagtgggtagaacacgtgcgagcagaaagaggtgacgatgttgtcatcatgttg
ttgggtaacaagattgatttggataacaaaagacaagtcactgcagaacagggtgaagaa
aaatccagaaacctcaatgtgatgtttattgagaccagtgccaaaaccggttacaacgtg
aaaaagctgttccggcgtgtggcttctgcccttctttccacaaggacttcacctccacca
aaagaggggacggttgaaatcgaactggaatccttcgaggagtcaggcaacagaagctat
tgttga

DBGET integrated database retrieval system